ADP,ATP carrier protein 3 (AAC3) Recombinant Protein | AAC3 recombinant protein
Recombinant Saccharomyces cerevisiae ADP,ATP carrier protein 3 (AAC3)
Gene Names
AAC3; ANC3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ADP; ATP carrier protein 3 (AAC3); Recombinant Saccharomyces cerevisiae ADP; Recombinant ADP; ATP carrier protein 3; ADP/ATP translocase 3 Adenine nucleotide translocator 3; ANT 3; AAC3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-307
Sequence
MSSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQMILFGKKFK
Sequence Length
307
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33,313 Da
NCBI Official Full Name
Aac3p
NCBI Official Symbol
AAC3
NCBI Official Synonym Symbols
ANC3
NCBI Protein Information
Aac3p
UniProt Protein Name
ADP,ATP carrier protein 3
Protein Family
UniProt Gene Name
AAC3
UniProt Synonym Gene Names
ANT 3
UniProt Entry Name
ADT3_YEAST
Uniprot Description
Function: Catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane.
Subunit structure: Homodimer.
Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein.
Miscellaneous: The transmembrane helices are not perpendicular to the plane of the membrane, but cross the membrane at an angle. At least 2 of the odd-numbered transmembrane helices exhibit a sharp kink, due to the presence of a conserved proline residue
By similarity.Present with 1080 molecules/cell in log phase SD medium.
Sequence similarities: Belongs to the mitochondrial carrier family.Contains 3 Solcar repeats.
Similar Products
Product Notes
The AAC3 aac3 (Catalog #AAA1105029) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-307. The amino acid sequence is listed below: MSSDAKQQET NFAINFLMGG VSAAIAKTAA SPIERVKILI QNQDEMIKQG TLDKKYSGIV DCFKRTAKQE GLISFWRGNT ANVIRYFPTQ ALNFAFKDKI KLMFGFKKEE GYGKWFAGNL ASGGAAGALS LLFVYSLDFA RTRLAADAKS SKKGGARQFN GLTDVYKKTL KSDGIAGLYR GFMPSVVGIV VYRGLYFGMF DSLKPLVLTG SLDGSFLASF LLGWVVTTGA STCSYPLDTV RRRMMMTSGQ AVKYNGAIDC LKKIVASEGV GSLFKGCGAN ILRSVAGAGV ISMYDQLQMI LFGKKFK. It is sometimes possible for the material contained within the vial of "ADP,ATP carrier protein 3 (AAC3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
