ADP,ATP carrier protein 2, mitochondrial (AAC2) Recombinant Protein | AAC2 recombinant protein
Recombinant Arabidopsis thaliana ADP,ATP carrier protein 2, mitochondrial (AAC2)
Gene Names
AAC2; ADP/ATP carrier 2; T6I14.20; T6I14_20
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ADP; ATP carrier protein 2; mitochondrial (AAC2); Recombinant Arabidopsis thaliana ADP; AAC2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
75-385
Sequence
APGEKGFTNFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDSKSAKKGGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCAGIIVYRGLYFGLYDSVKPVLLTGDLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKKEGAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA
Sequence Length
385
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for AAC2 recombinant protein
AAC2; ANT2
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,746 Da
NCBI Official Full Name
ADP,ATP carrier protein 2
NCBI Official Symbol
AAC2
NCBI Official Synonym Symbols
ADP/ATP carrier 2; T6I14.20; T6I14_20
NCBI Protein Information
ADP,ATP carrier protein 2
UniProt Protein Name
ADP,ATP carrier protein 2, mitochondrial
UniProt Gene Name
AAC2
UniProt Synonym Gene Names
ANT2; ANT 2
UniProt Entry Name
ADT2_ARATH
Uniprot Description
Function: Catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane.
Subunit structure: Homodimer
By similarity.
Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein.
Miscellaneous: The transmembrane helices are not perpendicular to the plane of the membrane, but cross the membrane at an angle. At least 2 of the odd-numbered transmembrane helices exhibit a sharp kink, due to the presence of a conserved proline residue
By similarity.
Sequence similarities: Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification]Contains 3 Solcar repeats.
Similar Products
Product Notes
The AAC2 aac2 (Catalog #AAA1235167) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 75-385. The amino acid sequence is listed below: APGEKGFTNF AIDFMMGGVS AAVSKTAAAP IERVKLLIQN QDEMLKAGRL TEPYKGIRDC FGRTIRDEGI GSLWRGNTAN VIRYFPTQAL NFAFKDYFKR LFNFKKDKDG YWKWFAGNLA SGGAAGASSL LFVYSLDYAR TRLANDSKSA KKGGGERQFN GLVDVYKKTL KSDGIAGLYR GFNISCAGII VYRGLYFGLY DSVKPVLLTG DLQDSFFASF ALGWLITNGA GLASYPIDTV RRRMMMTSGE AVKYKSSFDA FSQIVKKEGA KSLFKGAGAN ILRAVAGAGV LAGYDKLQLI VFGKKYGSGG A. It is sometimes possible for the material contained within the vial of "ADP,ATP carrier protein 2, mitochondrial (AAC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
