Putative apoptosis regulator A9 (A9) Recombinant Protein | AlHV1gp70 recombinant protein
Recombinant Alcelaphine herpesvirus 1 Putative apoptosis regulator A9 (A9)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative apoptosis regulator A9 (A9); Recombinant Alcelaphine herpesvirus 1 Putative apoptosis regulator A9 (A9); Recombinant Putative apoptosis regulator A9 (A9); Putative apoptosis regulator A9; AlHV1gp70 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-168
Sequence
MKMLGEPEFKENILYYSFLNELFLILIRNGFSCSHAKLILDETRKRGLECSGQFEVISNSVEAPEPESLERIAKTLFTPRPHWGRLVAFLAYLAYLQKNSTEKLFWNDHLKKLKQIVKCHIVPWTLGPRDPKPKQRPFDKLPSAFYFLTAAASCLTLLLLYFRTTQTK
Sequence Length
168
Species
Alcelaphine herpesvirus 1 (strain C500) (AIHV-1) (Malignant catarrhal fever virus)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19,555 Da
NCBI Official Full Name
A9
NCBI Official Symbol
AlHV1gp70
NCBI Protein Information
similar to Bcl-family of proteins; contains only conserved BH1 domain; A9
UniProt Protein Name
Putative apoptosis regulator A9
UniProt Gene Name
A9
UniProt Entry Name
VGA9_ALHV1
Uniprot Description
Function: Suppresses apoptosis in host cell and thus facilitates production of progeny virions
By similarity.
Subcellular location: Host membrane; Single-pass membrane protein
Potential.
Similar Products
Product Notes
The AlHV1gp70 a9 (Catalog #AAA1078385) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-168. The amino acid sequence is listed below: MKMLGEPEFK ENILYYSFLN ELFLILIRNG FSCSHAKLIL DETRKRGLEC SGQFEVISNS VEAPEPESLE RIAKTLFTPR PHWGRLVAFL AYLAYLQKNS TEKLFWNDHL KKLKQIVKCH IVPWTLGPRD PKPKQRPFDK LPSAFYFLTA AASCLTLLLL YFRTTQTK. It is sometimes possible for the material contained within the vial of "Putative apoptosis regulator A9 (A9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
