Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Putative C-type lectin protein A7 (A7) Recombinant Protein | AlHV1gp47 recombinant protein

Recombinant Alcelaphine herpesvirus 1 Putative C-type lectin protein A7 (A7)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative C-type lectin protein A7 (A7); Recombinant Alcelaphine herpesvirus 1 Putative C-type lectin protein A7 (A7); Recombinant Putative C-type lectin protein A7 (A7); Putative C-type lectin protein A7; AlHV1gp47 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-243
Sequence
MLAEMLWPAVNMLLPRKALLVDIFFILAATNLMIAAFALGCLAFYKQLVYITIGNLTFPHQSGDEVIRAMYIPPVNDSVDFNPGFRLSWLNTLSPLSDGPYDSWSQCEICPGRFVGQKACYYVPPKTYSFQNCFFACKNISKCFYLYTPQNITDPFFDHTLRDQDIWIGTFFKKLNAALSTIDNNFDYTAWDELSVYCAYLTRRSRSTVYFTDCTTSKLCLCGQEDFTPAPFYEALTPAPVHG
Sequence Length
243
Species
Alcelaphine herpesvirus 1 (strain C500) (AIHV-1) (Malignant catarrhal fever virus)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,679 Da
NCBI Official Full Name
A7
NCBI Official Symbol
AlHV1gp47
NCBI Protein Information
positional similar to BZLF2; A7
UniProt Protein Name
Putative C-type lectin protein A7
UniProt Gene Name
A7
UniProt Entry Name
VGA7_ALHV1

Uniprot Description

Subcellular location: Host membrane; Single-pass membrane protein

Potential.

Sequence similarities: Contains 1 C-type lectin domain.

Similar Products

Product Notes

The AlHV1gp47 a7 (Catalog #AAA1060211) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-243. The amino acid sequence is listed below: MLAEMLWPAV NMLLPRKALL VDIFFILAAT NLMIAAFALG CLAFYKQLVY ITIGNLTFPH QSGDEVIRAM YIPPVNDSVD FNPGFRLSWL NTLSPLSDGP YDSWSQCEIC PGRFVGQKAC YYVPPKTYSF QNCFFACKNI SKCFYLYTPQ NITDPFFDHT LRDQDIWIGT FFKKLNAALS TIDNNFDYTA WDELSVYCAY LTRRSRSTVY FTDCTTSKLC LCGQEDFTPA PFYEALTPAP VHG. It is sometimes possible for the material contained within the vial of "Putative C-type lectin protein A7 (A7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.