Group XIIA secretory phospholipase A2 Recombinant Protein | PLA2G12A recombinant protein

Recombinant Human Group XIIA secretory phospholipase A2

Cat. Num. AAA969748

• Gene Names: PLA2G12A; GXII; ROSSY; PLA2G12
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Group XIIA secretory phospholipase A2; Recombinant Human Group XIIA secretory phospholipase A2; Phosphatidylcholine 2-acylhydrolase 12A; PLA2G12A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 23-185aa; Partial of the full length of 23-189aa
• Sequence: QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEE
• Sequence Length: 189

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for PLA2G12A recombinant protein

PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.

Product Categories/Family for PLA2G12A recombinant protein

Metabolism

References

Cloning and recombinant expression of a structurally novel human secreted phospholipase A2.Gelb M.H., Valentin E., Ghomashchi F., Lazdunski M., Lambeau G.J. Biol. Chem. 275:39823-39826(2000) Identification of FKSG38, a novel gene located on human chromosome 4q25.Wang Y.-G., Gong L.The secreted protein discovery initiative (SPDI) , a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003) Cellular arachidonate-releasing function of novel classes of secretory phospholipase A2s (groups III and XII) .Murakami M., Masuda S., Shimbara S., Bezzine S., Lazdunski M., Lambeau G., Gelb M.H., Matsukura S., Kokubu F., Adachi M., Kudo I.J. Biol. Chem. 278:10657-10667(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 21361944
• NCBI GeneID: 81579
• NCBI Accession #: NP_110448.2
• NCBI GenBank Nucleotide #: NM_030821.4
• UniProt Accession #: Q9BZM1; Q9BZ89
• Molecular Weight: 20.3 kDa
• NCBI Official Full Name: group XIIA secretory phospholipase A2
• NCBI Official Synonym Full Names: phospholipase A2 group XIIA
• NCBI Official Symbol: PLA2G12A
• NCBI Official Synonym Symbols: GXII; ROSSY; PLA2G12
• NCBI Protein Information: group XIIA secretory phospholipase A2
• UniProt Protein Name: Group XIIA secretory phospholipase A2
• Protein Family: Group XIIA secretory phospholipase
• UniProt Gene Name: PLA2G12A
• UniProt Synonym Gene Names: PLA2G12; GXII sPLA2; sPLA2-XII
• UniProt Entry Name: PG12A_HUMAN

NCBI Description

Secreted phospholipase A2 (sPLA2) enzymes liberate arachidonic acid from phospholipids for production of eicosanoids and exert a variety of physiologic and pathologic effects. Group XII sPLA2s, such as PLA2G12A, have relatively low specific activity and are structurally and functionally distinct from other sPLA2s (Gelb et al., 2000 [PubMed 11031251]).[supplied by OMIM, Mar 2008]

Uniprot Description

PLA2G12A: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl- phosphatidylcholine or -phosphatidylethanolamine. Belongs to the phospholipase A2 family.

Protein type: Secreted, signal peptide; Lipid Metabolism - linoleic acid; Secreted; Lipid Metabolism - ether lipid; EC 3.1.1.4; Lipid Metabolism - arachidonic acid; Lipid Metabolism - alpha-linolenic acid; Lipid Metabolism - glycerophospholipid; Phospholipase; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 4q25

Cellular Component: endoplasmic reticulum; extracellular region; Golgi apparatus

Molecular Function: calcium ion binding; calcium-dependent phospholipase A2 activity

Biological Process: glycerophospholipid biosynthetic process; lipid catabolic process; phosphatidic acid biosynthetic process; phospholipid metabolic process