Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

B-lymphocyte antigen CD20 Recombinant Protein | Ms4a1 recombinant protein

Recombinant Mouse B-lymphocyte antigen CD20

Gene Names
Ms4a1; Cd20; Ly-44; Ms4a2; AA960661
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
B-lymphocyte antigen CD20; Recombinant Mouse B-lymphocyte antigen CD20; B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD20; Ms4a1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
132-291aa; Partial
Sequence
ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Sequence Length
291
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Ms4a1 recombinant protein
This protein may be involved in the regulation of B-cell activation and proliferation.
References
Cloning of a complementary DNA encoding a new mouse B lymphocyte differentiation antigen, homologous to the human B1 (CD20) antigen, and localization of the gene to chromosome 19.Tedder T.F., Klejman G., Disteche C.M., Adler D.A., Schlossman S.F., Saito H.J. Immunol. 141:4388-4394(1988) The oligomeric nature of the murine Fc epsilon RII/CD23. Implications for function.Dierks S.E., Bartlett W.C., Edmeades R.L., Gould H.J., Rao M., Conrad D.H.J. Immunol. 150:2372-2382(1993) CD20 deficiency in humans results in impaired T cell-independent antibody responses.Kuijpers T.W., Bende R.J., Baars P.A., Grummels A., Derks I.A.M., Dolman K.M., Beaumont T., Tedder T.F., van Noesel C.J.M., Eldering E., van Lier R.A.W.J. Clin. Invest. 120:214-222(2010)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.1 kDa
NCBI Official Full Name
B-lymphocyte antigen CD20
NCBI Official Synonym Full Names
membrane-spanning 4-domains, subfamily A, member 1
NCBI Official Symbol
Ms4a1
NCBI Official Synonym Symbols
Cd20; Ly-44; Ms4a2; AA960661
NCBI Protein Information
B-lymphocyte antigen CD20
UniProt Protein Name
B-lymphocyte antigen CD20
Protein Family
UniProt Gene Name
Ms4a1
UniProt Synonym Gene Names
Cd20; Ly-44; Ms4a2
UniProt Entry Name
CD20_MOUSE

Uniprot Description

MS4A1: This protein may be involved in the regulation of B-cell activation and proliferation. Defects in MS4A1 are the cause of immunodeficiency common variable type 5 (CVID5); also called antibody deficiency due to CD20 defect. CVID5 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low. Belongs to the MS4A family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Cell surface

Cellular Component: external side of plasma membrane; extracellular space; integral to membrane; integral to plasma membrane; membrane; plasma membrane

Molecular Function: epidermal growth factor receptor binding; protein binding

Biological Process: B cell activation

Research Articles on Ms4a1

Similar Products

Product Notes

The Ms4a1 ms4a1 (Catalog #AAA969574) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 132-291aa; Partial. The amino acid sequence is listed below: ILNMTLSHFL KMRRLELIQT SKPYVDIYDC EPSNSSEKNS PSTQYCNSIQ SVFLGILSAM LISAFFQKLV TAGIVENEWK RMCTRSKSNV VLLSAGEKNE QTIKMKEEII ELSGVSSQPK NEEEIEIIPV QEEEEEEAEI NFPAPPQEQE SLPVENEIAP. It is sometimes possible for the material contained within the vial of "B-lymphocyte antigen CD20, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.