E3 SUMO-protein ligase EGR2 (Egr2) Recombinant Protein | Egr2 recombinant protein
Recombinant Mouse E3 SUMO-protein ligase EGR2 (Egr2)
Gene Names
Egr2; Egr-2; Zfp-6; Krox20; NGF1-B; Zfp-25; Krox-20
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 SUMO-protein ligase EGR2 (Egr2); Recombinant Mouse E3 SUMO-protein ligase EGR2 (Egr2); Egr2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-470, Full length protein
Sequence
MMTAKAVDKIPVTLSGFMHQLPDSLYPVEDLAASSVTIFPNGELGGPFDQMNGVAGDGMINIDMTGEKRPLDLPYPSSFAPISAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTPPASTTASSSVTSASPNPLATGPLGVCTMSQTQPELDHLYSPPPPPPPYSGCTGDLYQDPSAFLSPPSTTSTSSLAYQPPPSYPSPKPAMDPGLIPMIPDYPGFFPSPCQRDPHGAAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPGAGVTGPGASGGGEGPRLPGSGSAAVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSAPPSAQSSASGPGGSQAGGSLCGNSAIGGPLASCTSRTRTP
Sequence Length
470
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Egr2 recombinant protein
This protein is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,500 Da
NCBI Official Full Name
E3 SUMO-protein ligase EGR2 isoform 2
NCBI Official Synonym Full Names
early growth response 2
NCBI Official Symbol
Egr2
NCBI Official Synonym Symbols
Egr-2; Zfp-6; Krox20; NGF1-B; Zfp-25; Krox-20
NCBI Protein Information
E3 SUMO-protein ligase EGR2
UniProt Protein Name
E3 SUMO-protein ligase EGR2
Protein Family
UniProt Gene Name
Egr2
UniProt Synonym Gene Names
Egr-2; Krox-20; Zfp-25; EGR-2
Uniprot Description
Sequence-specific DNA-binding transcription factor. Binds to two specific DNA sites located in the promoter region of HOXA4. Binds to the promoter region of ERBB2. May play a role in the regulation of hindbrain segmentation, might act in combination with the Hox network to specify odd and even rhombomeres, and might participate in the control of the expression of some of the homeobox containing genes.
Research Articles on Egr2
Similar Products
Product Notes
The Egr2 egr2 (Catalog #AAA968689) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-470, Full length protein. The amino acid sequence is listed below: MMTAKAVDKI PVTLSGFMHQ LPDSLYPVED LAASSVTIFP NGELGGPFDQ MNGVAGDGMI NIDMTGEKRP LDLPYPSSFA PISAPRNQTF TYMGKFSIDP QYPGASCYPE GIINIVSAGI LQGVTPPAST TASSSVTSAS PNPLATGPLG VCTMSQTQPE LDHLYSPPPP PPPYSGCTGD LYQDPSAFLS PPSTTSTSSL AYQPPPSYPS PKPAMDPGLI PMIPDYPGFF PSPCQRDPHG AAGPDRKPFP CPLDSLRVPP PLTPLSTIRN FTLGGPGAGV TGPGASGGGE GPRLPGSGSA AVTATPYNPH HLPLRPILRP RKYPNRPSKT PVHERPYPCP AEGCDRRFSR SDELTRHIRI HTGHKPFQCR ICMRNFSRSD HLTTHIRTHT GEKPFACDYC GRKFARSDER KRHTKIHLRQ KERKSSAPSA PPSAQSSASG PGGSQAGGSL CGNSAIGGPL ASCTSRTRTP. It is sometimes possible for the material contained within the vial of "E3 SUMO-protein ligase EGR2 (Egr2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
