Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Haptoglobin (HP) Recombinant Protein | HP recombinant protein

Recombinant Dog Haptoglobin (HP)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Haptoglobin (HP); Recombinant Dog Haptoglobin (HP); HP recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-329, Full length protein
Sequence
EDTGSEATNNTEVSLPKPPVIENGYVEHMIRYQCKPFYKLHTEGDGVYTLNSEKHWTNKAVGEKLPECEAVCGKPKNPVDQVQRIMGGSVDAKGSFPWQAKMVSHHNLTSGATLINEQWLLTTAKNLFLGHKDDAKANDIAPTLKLYVGKNQLVEVEKVVLHPDYSKVDIGLIKLKQKVPIDERVMPICLPSKDYAEVGRIGYVSGWGRNSNFNFTELLKYVMLPVADQDKCVQHYEGSTVPEKKSPKSPVGVQPILNEHTFCAGMSKFQEDTCYGDAGSAFAVHDQDEDTWYAAGILSFDKSCTVAEYGVYVKVPSVLAWVQETIAGN
Sequence Length
329
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for HP recombinant protein
This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin, which allows degradative enzymes to gain access to the hemoglobin, while at the same time preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin. Mutations in this gene and
or its regulatory regions cause ahaptoglobinemia or hypohaptoglobinemia. This gene has also been linked to diabetic nephropathy, the incidence of coronary artery disease in type 1 diabetes, Crohn s disease, inflammatory disease behavior, primary sclerosing cholangitis, susceptibility to idiopathic Parkinson s disease, and a reduced incidence of Plasmodium falciparum malaria. A similar duplicated gene is located next to this gene on chromosome 16. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
36,457 Da
NCBI Official Full Name
Haptoglobin
UniProt Protein Name
Haptoglobin
UniProt Gene Name
HP

Uniprot Description

As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway ().

Similar Products

Product Notes

The HP hp (Catalog #AAA968251) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-329, Full length protein. The amino acid sequence is listed below: EDTGSEATNN TEVSLPKPPV IENGYVEHMI RYQCKPFYKL HTEGDGVYTL NSEKHWTNKA VGEKLPECEA VCGKPKNPVD QVQRIMGGSV DAKGSFPWQA KMVSHHNLTS GATLINEQWL LTTAKNLFLG HKDDAKANDI APTLKLYVGK NQLVEVEKVV LHPDYSKVDI GLIKLKQKVP IDERVMPICL PSKDYAEVGR IGYVSGWGRN SNFNFTELLK YVMLPVADQD KCVQHYEGST VPEKKSPKSP VGVQPILNEH TFCAGMSKFQ EDTCYGDAGS AFAVHDQDED TWYAAGILSF DKSCTVAEYG VYVKVPSVLA WVQETIAGN. It is sometimes possible for the material contained within the vial of "Haptoglobin (HP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.