ATP synthase subunit epsilon, mitochondrial (Atp5e) Recombinant Protein | Atp5e recombinant protein

Recombinant Rat ATP synthase subunit epsilon, mitochondrial (Atp5e)

Cat. Num. AAA968217

• Gene Names: Atp5f1e; Atp5e
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATP synthase subunit epsilon; mitochondrial (Atp5e); Recombinant Rat ATP synthase subunit epsilon; Atp5e recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-51, Full length protein
• Sequence: VAYWRQAGLSYIRFSQICAKAVRDALKTEFKANAEKTSGTSIKTVKIKKE
• Sequence Length: 50

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Atp5e recombinant protein

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13.

NCBI and Uniprot Product Information

• NCBI GI #: 20806139
• NCBI GeneID: 245958
• NCBI Accession #: NP_620799.1
• NCBI GenBank Nucleotide #: NM_139099.1
• UniProt Accession #: P29418
• Molecular Weight: 5,767 Da
• NCBI Official Full Name: ATP synthase subunit epsilon, mitochondrial
• NCBI Official Synonym Full Names: ATP synthase F1 subunit epsilon
• NCBI Official Symbol: Atp5f1e
• NCBI Official Synonym Symbols: Atp5e
• NCBI Protein Information: ATP synthase subunit epsilon, mitochondrial
• UniProt Protein Name: ATP synthase subunit epsilon, mitochondrial
• UniProt Gene Name: Atp5e
• UniProt Synonym Gene Names: ATPase subunit epsilon

NCBI Description

human homolog is the epsilon subunit of human ATP synthase [RGD, Feb 2006]

Uniprot Description

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F1 domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha3beta3 subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.