Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (UBE2G2 monoclonal antibody, Western Blot analysis of UBE2G2 expression in HeLa.)

Mouse anti-Human UBE2G2 Monoclonal Antibody | anti-UBE2G2 antibody

UBE2G2 (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin Carrier Protein G2, Ubiquitin-protein Ligase G2, UBC7)

Gene Names
UBE2G2; UBC7
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
UBE2G2; Monoclonal Antibody; UBE2G2 (Ubiquitin-conjugating Enzyme E2 G2; Ubiquitin Carrier Protein G2; Ubiquitin-protein Ligase G2; UBC7); Anti -UBE2G2 (Ubiquitin-conjugating Enzyme E2 G2; anti-UBE2G2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5E1
Specificity
Recognizes human UBE2G2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGR
Applicable Applications for anti-UBE2G2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml
Immunogen
Partial recombinant corresponding to aa1-87 from human UBE2G2 (NP_003334.2) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(UBE2G2 monoclonal antibody, Western Blot analysis of UBE2G2 expression in HeLa.)

Western Blot (WB) (UBE2G2 monoclonal antibody, Western Blot analysis of UBE2G2 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of UBE2G2 expression in transfected 293T cell line by UBE2G2 monoclonal antibody.|Lane 1: UBE2G2 transfected lysate (15.6KD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UBE2G2 expression in transfected 293T cell line by UBE2G2 monoclonal antibody.|Lane 1: UBE2G2 transfected lysate (15.6KD).|Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to UBE2G2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to UBE2G2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1ug/ml])

Testing Data

(Detection limit for recombinant GST tagged UBE2G2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UBE2G2 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-UBE2G2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,566 Da
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 G2 isoform 3
NCBI Official Synonym Full Names
ubiquitin-conjugating enzyme E2G 2
NCBI Official Symbol
UBE2G2
NCBI Official Synonym Symbols
UBC7
NCBI Protein Information
ubiquitin-conjugating enzyme E2 G2; ubiquitin-protein ligase G2; ubiquitin carrier protein G2; ubiquitin conjugating enzyme 7; ubiquitin conjugating enzyme G2; ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast); ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7)
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 G2
UniProt Gene Name
UBE2G2
UniProt Entry Name
UB2G2_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

UBE2G2: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys- 48'-linked polyubiquitination. Involved in endoplasmic reticulum- associated degradation (ERAD). Belongs to the ubiquitin-conjugating enzyme family.

Protein type: EC 6.3.2.19; Ubiquitin conjugating system; Ubiquitin ligase; Ligase; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: endoplasmic reticulum; cytosol

Molecular Function: identical protein binding; protein binding; small conjugating protein ligase activity; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; ATP binding; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; ER-associated protein catabolic process; cellular protein catabolic process; protein amino acid N-linked glycosylation via asparagine

Research Articles on UBE2G2

Similar Products

Product Notes

The UBE2G2 ube2g2 (Catalog #AAA6001867) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE2G2 (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin Carrier Protein G2, Ubiquitin-protein Ligase G2, UBC7) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2G2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml. Researchers should empirically determine the suitability of the UBE2G2 ube2g2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGTALKRLM AEYKQLTLNP PEGIVAGPMN EENFFEWEAL IMGPEDTCFE FGVFPAILSF PLDYPLSPPK MRFTCEMFHP NIYPDGR. It is sometimes possible for the material contained within the vial of "UBE2G2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.