Signal transducing adapter molecule 1 (Stam) Recombinant Protein | Stam recombinant protein
Recombinant Mouse Signal transducing adapter molecule 1 (Stam)
Gene Names
Stam; STAM1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Signal transducing adapter molecule 1 (Stam); Recombinant Mouse Signal transducing adapter molecule 1 (Stam); Stam recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-548
, Full length protein
Sequence
PLFATNPFDQDVEKATSELNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVATKKEEEDLAKAIELSLKEQRQQSAPVSTLYPSTSNLLTNHQHEGRKVRAVYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGVGLFPSNFVTADLTAEPEMIKTEKKTVQFNDDVQIETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQSQQYYLQSSAVSASQVYPGPAQSGTYLVAGSAQMTHLQSYSLPPEQLSSISQGAVPSSANQALPSQQTQASYPNAMVSSVQGNSYPSQASIYSPPAAAAAAAAAAVVPVPVPADVTIYQNAGPTMSQVPNYTLTSSTLPQTGGSQQPPQPQQAYSQKALL
Sequence Length
547
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Stam recombinant protein
This gene was identified by the rapid tyrosine-phosphorylation of its product in response to cytokine stimulation. The encoded protein contains a SH3 domain and the immunoreceptor tyrosine-based activation motif (ITAM). This protein associates with JAK3 and JAK2 kinases via its ITAM region, and is phosphorylated by the JAK kinases upon cytokine stimulation, which suggests the function of this protein is as an adaptor molecule involved in the downstream signaling of cytokine receptors. HGS
HRS (hepatocyte grwoth factor-regulated tyrosine kinase substrate) has been found to bind and counteract the function of this protein.
HRS (hepatocyte grwoth factor-regulated tyrosine kinase substrate) has been found to bind and counteract the function of this protein.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,771 Da
NCBI Official Full Name
signal transducing adapter molecule 1 isoform 1
NCBI Official Synonym Full Names
signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
NCBI Official Symbol
Stam
NCBI Official Synonym Symbols
STAM1
NCBI Protein Information
signal transducing adapter molecule 1
UniProt Protein Name
Signal transducing adapter molecule 1
Protein Family
UniProt Gene Name
Stam
UniProt Synonym Gene Names
Stam1; STAM-1
Uniprot Description
Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with HGS (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes ().
Research Articles on Stam
Similar Products
Product Notes
The Stam stam (Catalog #AAA967736) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-548 , Full length protein. The amino acid sequence is listed below: PLFATNPFDQ DVEKATSELN TAEDWGLILD ICDKVGQSRT GPKDCLRSIM RRVNHKDPHV AMQALTLLGA CVSNCGKIFH LEVCSRDFAS EVSNVLNKGH PKVCEKLKAL MVEWTDEFKN DPQLSLISAM IKNLKEQGVT FPAIGSQAAE QAKASPALVA KDPGTVATKK EEEDLAKAIE LSLKEQRQQS APVSTLYPST SNLLTNHQHE GRKVRAVYDF EAAEDNELTF KAGEIITVLD DSDPNWWKGE THQGVGLFPS NFVTADLTAE PEMIKTEKKT VQFNDDVQIE TIEPEPEPAF IDEDKMDQLL QMLQSTDPSD NQPDLPELLH LEAMCHQMGP LIDEKLEDID RKHSELSELN VKVMEALSLY TKLMNEDPMY SMYAKLQSQQ YYLQSSAVSA SQVYPGPAQS GTYLVAGSAQ MTHLQSYSLP PEQLSSISQG AVPSSANQAL PSQQTQASYP NAMVSSVQGN SYPSQASIYS PPAAAAAAAA AAVVPVPVPA DVTIYQNAGP TMSQVPNYTL TSSTLPQTGG SQQPPQPQQA YSQKALL. It is sometimes possible for the material contained within the vial of "Signal transducing adapter molecule 1 (Stam), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
