Delta-type opioid receptor (OPRD1) Recombinant Protein | OPRD1 recombinant protein
Recombinant Pig Delta-type opioid receptor (OPRD1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Delta-type opioid receptor (OPRD1); Recombinant Pig Delta-type opioid receptor (OPRD1); Recombinant Delta-type opioid receptor (OPRD1); Delta-type opioid receptor; D-OR-1; DOR-1; OPRD1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-228
Sequence
GIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILVITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
Sequence Length
228
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
25,725 Da
NCBI Official Full Name
Delta-type opioid receptor
NCBI Official Symbol
OPRD1
NCBI Protein Information
opioid receptor, delta 1; delta opioid receptor; Delta-type opioid receptor
UniProt Protein Name
Delta-type opioid receptor
Protein Family
UniProt Gene Name
OPRD1
UniProt Synonym Gene Names
D-OR-1; DOR-1
UniProt Entry Name
OPRD_PIG
Uniprot Description
Function: Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Highly stereoselective. receptor for enkephalins
By similarity.
Subunit structure: Interacts with GPRASP1
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
Similar Products
Product Notes
The OPRD1 oprd1 (Catalog #AAA967701) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-228. The amino acid sequence is listed below: GIVRYTKMKT ATNIYIFNLA LADALATSTL PFQSAKYLME TWPFGELLCK AVLSIDYYNM FTSIFTLTMM SVDRYIAVCH PVKALDFRTP AKAKLINICI WVLASGVGVP IMVMAVTRPR DGAVVCMLQF PSPSWYWDTV TKICVFLFAF VVPILVITVC YGLMLLRLRS VRLLSGSKEK DRSLRRITRM VLVVVGAFVV CWAPIHIFVI VWTLVDIDRR DPLVVAAL. It is sometimes possible for the material contained within the vial of "Delta-type opioid receptor (OPRD1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
