Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Pancreatic secretory trypsin inhibitor (Spink1) Recombinant Protein | Spink1 recombinant protein

Recombinant Rat Pancreatic secretory trypsin inhibitor (Spink1)

Gene Names
Spink3; Tilp; Psti-1; Spink1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pancreatic secretory trypsin inhibitor (Spink1); Recombinant Rat Pancreatic secretory trypsin inhibitor (Spink1); Spink1 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-79, Full length protein
Sequence
GNPPAEVNGKTPNCPKQIMGCPRIYDPVCGTNGITYPSECSLCFENRKFGTSIHIQRRGTC
Sequence Length
61
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Spink1 recombinant protein
This protein is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8,528 Da
NCBI Official Full Name
serine protease inhibitor Kazal-type 1
NCBI Official Synonym Full Names
serine peptidase inhibitor, Kazal type 3
NCBI Official Symbol
Spink3
NCBI Official Synonym Symbols
Tilp; Psti-1; Spink1
NCBI Protein Information
serine protease inhibitor Kazal-type 1
UniProt Protein Name
Serine protease inhibitor Kazal-type 1
UniProt Gene Name
Spink1
UniProt Synonym Gene Names
PSTI-I

NCBI Description

acts as a trypsin inhibitor to protect the pancreas from premature activation of pancreatic juice; has additional monitor peptide activity to induce cholecystokinin release in the intestine [RGD, Feb 2006]

Uniprot Description

Serine protease inhibitor which exhibits anti-trypsin activity (PubMed:3202973, PubMed:3597401). In the pancreas, protects against trypsin-catalyzed premature activation of zymogens ().

Research Articles on Spink1

Similar Products

Product Notes

The Spink1 spink1 (Catalog #AAA967640) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-79, Full length protein. The amino acid sequence is listed below: GNPPAEVNGK TPNCPKQIMG CPRIYDPVCG TNGITYPSEC SLCFENRKFG TSIHIQRRGT C. It is sometimes possible for the material contained within the vial of "Pancreatic secretory trypsin inhibitor (Spink1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual