Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

14-3-3 protein eta (YWHAH) Recombinant Protein | YWHAH recombinant protein

Recombinant Bovine 14-3-3 protein eta (YWHAH)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
14-3-3 protein eta (YWHAH); Recombinant Bovine 14-3-3 protein eta (YWHAH); YWHAH recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-246, Full length protein
Sequence
GDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
Sequence Length
245
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for YWHAH recombinant protein
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5 UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,212 Da
NCBI Official Full Name
14-3-3 protein eta
NCBI Official Symbol
YWHAH
NCBI Protein Information
14-3-3 protein eta
UniProt Protein Name
14-3-3 protein eta
Protein Family
UniProt Gene Name
YWHAH
UniProt Synonym Gene Names
KCIP-1

Uniprot Description

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1 ().

Similar Products

Product Notes

The YWHAH ywhah (Catalog #AAA967293) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-246, Full length protein. The amino acid sequence is listed below: GDREQLLQRA RLAEQAERYD DMASAMKAVT ELNEPLSNED RNLLSVAYKN VVGARRSSWR VISSIEQKTM ADGNEKKLEK VKAYREKIEK ELETVCNDVL ALLDKFLIKN CNDFQYESKV FYLKMKGDYY RYLAEVASGE KKNSVVEASE AAYKEAFEIS KEHMQPTHPI RLGLALNFSV FYYEIQNAPE QACLLAKQAF DDAIAELDTL NEDSYKDSTL IMQLLRDNLT LWTSDQQDEE AGEGN. It is sometimes possible for the material contained within the vial of "14-3-3 protein eta (YWHAH), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.