Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein-L-isoaspartate (D-aspartate) O-methyltransferase (PCMT1) Recombinant Protein | PCMT1 recombinant protein

Recombinant Human Protein-L-isoaspartate (D-aspartate) O-methyltransferase (PCMT1)

Gene Names
PCMT1; PIMT
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein-L-isoaspartate (D-aspartate) O-methyltransferase (PCMT1); Recombinant Human Protein-L-isoaspartate (D-aspartate) O-methyltransferase (PCMT1); PCMT1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-227, Full length protein
Sequence
AWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRWK
Sequence Length
226
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,679 Da
NCBI Official Full Name
protein-L-isoaspartate(D-aspartate) O-methyltransferase isoform 2
NCBI Official Synonym Full Names
protein-L-isoaspartate (D-aspartate) O-methyltransferase
NCBI Official Symbol
PCMT1
NCBI Official Synonym Symbols
PIMT
NCBI Protein Information
protein-L-isoaspartate(D-aspartate) O-methyltransferase
UniProt Protein Name
Protein-L-isoaspartate(D-aspartate) O-methyltransferase
UniProt Gene Name
PCMT1
UniProt Synonym Gene Names
PIMT

NCBI Description

This gene encodes a member of the type II class of protein carboxyl methyltransferase enzymes. The encoded enzyme plays a role in protein repair by recognizing and converting D-aspartyl and L-isoaspartyl residues resulting from spontaneous deamidation back to the normal L-aspartyl form. The encoded protein may play a protective role in the pathogenesis of Alzheimer's disease, and single nucleotide polymorphisms in this gene have been associated with spina bifida and premature ovarian failure. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. Acts on EIF4EBP2, microtubule-associated protein 2, calreticulin, clathrin light chains a and b, Ubiquitin carboxyl-terminal hydrolase isozyme L1, phosphatidylethanolamine-binding protein 1, stathmin, beta-synuclein and alpha-synuclein.

Research Articles on PCMT1

Similar Products

Product Notes

The PCMT1 pcmt1 (Catalog #AAA966255) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-227, Full length protein. The amino acid sequence is listed below: AWKSGGASHS ELIHNLRKNG IIKTDKVFEV MLATDRSHYA KCNPYMDSPQ SIGFQATISA PHMHAYALEL LFDQLHEGAK ALDVGSGSGI LTACFARMVG CTGKVIGIDH IKELVDDSVN NVRKDDPTLL SSGRVQLVVG DGRMGYAEEA PYDAIHVGAA APVVPQALID QLKPGGRLIL PVGPAGGNQM LEQYDKLQDG SIKMKPLMGV IYVPLTDKEK QWSRWK. It is sometimes possible for the material contained within the vial of "Protein-L-isoaspartate (D-aspartate) O-methyltransferase (PCMT1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.