Peroxisomal coenzyme A diphosphatase NUDT7 (NUDT7) Recombinant Protein | NUDT7 recombinant protein

Recombinant Human Peroxisomal coenzyme A diphosphatase NUDT7 (NUDT7)

Cat. Num. AAA964627

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Peroxisomal coenzyme A diphosphatase NUDT7 (NUDT7); Recombinant Human Peroxisomal coenzyme A diphosphatase NUDT7 (NUDT7); NUDT7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-238, Full length protein
• Sequence: MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTFEVQFNLNDVLASSEELFLKVHKKATSRL
• Sequence Length: 238

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for NUDT7 recombinant protein

This protein is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. Alternatively spliced transcript variants have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 157785656
• NCBI GeneID: 283927
• NCBI Accession #: NP_001099133.1
• NCBI GenBank Nucleotide #: NM_001105663.2
• UniProt Accession #: P0C024; B4DLE5; H3BUB8
• Molecular Weight: 18,724 Da
• NCBI Official Full Name: peroxisomal coenzyme A diphosphatase NUDT7 isoform 1
• NCBI Official Synonym Full Names: nudix hydrolase 7
• NCBI Official Symbol: NUDT7
• NCBI Protein Information: peroxisomal coenzyme A diphosphatase NUDT7
• UniProt Protein Name: Peroxisomal coenzyme A diphosphatase NUDT7
• Protein Family: Peroxisomal coenzyme A diphosphatase
• UniProt Gene Name: NUDT7
• UniProt Synonym Gene Names: Nudix motif 7

NCBI Description

The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

Coenzyme A diphosphatase which mediates the cleavage of CoA, CoA esters and oxidized CoA with similar efficiencies, yielding 3',5'-ADP and the corresponding 4'-phosphopantetheine derivative as products. CoA into 3',5'-ADP and 4'-phosphopantetheine. Has no activity toward NDP-sugars, CDP-alcohols, (deoxy)nucleoside 5'-triphosphates, nucleoside 5'-di or monophosphates, diadenosine polyphosphates, NAD, NADH, NADP, NADPH or thymidine-5'-monophospho-p-nitrophenyl ester. May be required to eliminate oxidized CoA from peroxisomes, or regulate CoA and acyl-CoA levels in this organelle in response to metabolic demand. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA ().