Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Dipeptidyl peptidase 1 (Ctsc) Recombinant Protein | Ctsc recombinant protein

Recombinant Rat Dipeptidyl peptidase 1 (Ctsc)

Gene Names
Ctsc; CATC; DPPI; DPP-I
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dipeptidyl peptidase 1 (Ctsc); Recombinant Rat Dipeptidyl peptidase 1 (Ctsc); Ctsc recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-134, Full length protein
Sequence
DTPANCTYPDLLGTWVFQVGPRHPRSHINCSVMEPTEEKVVIHLKKLDTAYDEVGNSGYFTLIYNQGFEIVLNDYKWFAFFKYEVKGSRAISYCHETMTGWVHDVLGRNW
Sequence Length
110
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ctsc recombinant protein
This protein, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in immune
inflammatory cells. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor, and a residual portion of the propeptide acts as an intramolecular chaperone for the folding and stabilization of the mature enzyme. This enzyme requires chloride ions for activity and can degrade glucagon. Defects in the encoded protein have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,235 Da
NCBI Official Full Name
dipeptidyl peptidase 1
NCBI Official Synonym Full Names
cathepsin C
NCBI Official Symbol
Ctsc
NCBI Official Synonym Symbols
CATC; DPPI; DPP-I
NCBI Protein Information
dipeptidyl peptidase 1
UniProt Protein Name
Dipeptidyl peptidase 1
Protein Family
UniProt Gene Name
Ctsc
UniProt Synonym Gene Names
DPP-I; DPPI

NCBI Description

acts as a cysteine dipeptidyl aminopeptidase; may play a role in immune and inflammatory response [RGD, Feb 2006]

Uniprot Description

Thiol protease. Has dipeptidylpeptidase activity. Can act as both an exopeptidase and endopeptidase ().

Research Articles on Ctsc

Similar Products

Product Notes

The Ctsc ctsc (Catalog #AAA963108) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-134, Full length protein. The amino acid sequence is listed below: DTPANCTYPD LLGTWVFQVG PRHPRSHINC SVMEPTEEKV VIHLKKLDTA YDEVGNSGYF TLIYNQGFEI VLNDYKWFAF FKYEVKGSRA ISYCHETMTG WVHDVLGRNW. It is sometimes possible for the material contained within the vial of "Dipeptidyl peptidase 1 (Ctsc), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.