Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Signal peptidase complex subunit 3 (SPCS3) Recombinant Protein | SPCS3 recombinant protein

Recombinant Dog Signal peptidase complex subunit 3 (SPCS3)

Gene Names
SPCS3; SPC22/23
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Signal peptidase complex subunit 3 (SPCS3); Recombinant Dog Signal peptidase complex subunit 3 (SPCS3); Recombinant Signal peptidase complex subunit 3 (SPCS3); Signal peptidase complex subunit 3 EC= 3.4.-.-; Microsomal signal peptidase 22/23 kDa subunit; SPC22/23; SPase 22/23 kDa subunit; SPCS3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-180aa; Full length protein
Sequence
MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRER SDLGFITFDITADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLL KDMKTKYFFFDDGNGLKGNRNVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY
Sequence Length
180
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,313 Da
NCBI Official Full Name
signal peptidase complex subunit 3
NCBI Official Symbol
SPCS3
NCBI Official Synonym Symbols
SPC22/23
NCBI Protein Information
signal peptidase complex subunit 3; SPase 22 kDa subunit; SPase 22/23 kDa subunit; microsomal signal peptidase 23 kDa subunit; microsomal signal peptidase 22/23 kDa subunit
UniProt Protein Name
Signal peptidase complex subunit 3
Protein Family
UniProt Gene Name
SPCS3
UniProt Synonym Gene Names
SPC22; SPC22/23
UniProt Entry Name
SPCS3_CANFA

Uniprot Description

SPCS3: Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. Belongs to the SPCS3 family.

Protein type: Cofactor and Vitamin Metabolism - biotin; Protease; Membrane protein, integral; Amino Acid Metabolism - lysine degradation; EC 3.4.-.-

Chromosomal Location of Human Ortholog: 4q34.2

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane; signal peptidase complex

Molecular Function: peptidase activity

Biological Process: SRP-dependent cotranslational protein targeting to membrane; cellular protein metabolic process; translation; signal peptide processing; gene expression; proteolysis; regulation of insulin secretion

Similar Products

Product Notes

The SPCS3 spcs3 (Catalog #AAA962990) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-180aa; Full length protein. The amino acid sequence is listed below: MNTVLSRANS LFAFSLSVMA ALTFGCFITT AFKDRSVPVR LHVSRIMLKN VEDFTGPRER SDLGFITFDI TADLENIFDW NVKQLFLYLS AEYSTKNNAL NQVVLWDKIV LRGDNPKLLL KDMKTKYFFF DDGNGLKGNR NVTLTLSWNV VPNAGILPLV TGSGHVSVPF PDTYEITKSY. It is sometimes possible for the material contained within the vial of "Signal peptidase complex subunit 3 (SPCS3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.