ATP synthase lipid-binding protein, mitochondrial (Atp5g3) Recombinant Protein | Atp5g3 recombinant protein

Recombinant Mouse ATP synthase lipid-binding protein, mitochondrial (Atp5g3)

• Gene Names: Atp5g3; 6030447M23
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATP synthase lipid-binding protein; mitochondrial (Atp5g3); Recombinant Mouse ATP synthase lipid-binding protein; Recombinant ATP synthase lipid-binding protein; mitochondrial; ATP synthase proteolipid P3 ATPase protein 9 ATPase subunit c; Atp5g3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 67-141
• Sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
• Sequence Length: 141

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 27923925
• NCBI GeneID: 228033
• NCBI Accession #: NP_778180.1
• NCBI GenBank Nucleotide #: NM_175015.2
• UniProt Accession #: P56384
• Molecular Weight: 14,745 Da
• NCBI Official Full Name: ATP synthase lipid-binding protein, mitochondrial
• NCBI Official Synonym Full Names: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9)
• NCBI Official Symbol: Atp5g3
• NCBI Official Synonym Symbols: 6030447M23
• NCBI Protein Information: ATP synthase lipid-binding protein, mitochondrial; ATPase protein 9; ATPase subunit c; ATP synthase proteolipid P3; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3
• UniProt Protein Name: ATP synthase lipid-binding protein, mitochondrial
• UniProt Gene Name: Atp5g3
• UniProt Entry Name: AT5G3_MOUSE

NCBI Description

The protein encoded by this gene is a subunit of mitochondrial membrane ATP synthase, the enzyme that catalyzes ATP synthesis during oxidative phosphorylation. This gene encodes subunit 9, which is present in multiple copies in the transmembrane part of the ATP synthase complex. Phenotype and gene expression profiles suggest correlations between this gene and alcoholism- and obesity-related phenotypes. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Sep 2014]

Uniprot Description

ATP5G3: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element. Belongs to the ATPase C chain family.

Protein type: Membrane protein, integral; Energy Metabolism - oxidative phosphorylation; Membrane protein, multi-pass

Cellular Component: mitochondrion; membrane; proton-transporting ATP synthase complex, coupling factor F(o); integral to membrane

Molecular Function: hydrogen ion transmembrane transporter activity; lipid binding

Biological Process: ATP synthesis coupled proton transport; proton transport; transport; ATP hydrolysis coupled proton transport; ion transport