DNA-binding protein RFX2 (Rfx2) Recombinant Protein | Rfx2 recombinant protein

Recombinant Mouse DNA-binding protein RFX2 (Rfx2)

Cat. Num. AAA961780

• Gene Names: Rfx2; 5430432H19Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DNA-binding protein RFX2 (Rfx2); Recombinant Mouse DNA-binding protein RFX2 (Rfx2); Rfx2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-717, Full length protein
• Sequence: MQNSEGGADSPASVALRPAAQPMPASPQRVLVQAAGSTPKGTPMQTLTLPRVQPVPPQVQHVYPAQVQYVEGGDAVYANGAIRAAYAYNPDPQLYAPSSAASYFETPGGTQVTVAASSPPAVPSHGMVGITMDVSGTPIVSGAGAYLIHGGMDGTRHSLAHTARSSPATLEMAIETLQKSEGLAPHKGGLLNSHLQWLLDNYETAEGVSLPRSSLYNHYLRHCQEHKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGIRLKPDSPLNRLQEDTQYMAMRQQPTHQKPRYRPAQKSDSLGDGSAHSNMHGMPDQAMATQGQHHQQYIDVSHVFPEFPAPDLGSTLLQESVTLHDVKALQLVYRRHCEATLDVVMNLQFQYIEKLWLSFWNCKATSSDSCASLPASDEDPEVTLLPKEKLISLCKCEPILQWMRSCDHILYQTLVETLIPDVLRPVPSSLTQAIRNFAKSLEGWLINAMSGFPQQVIQTKVGVVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCEESLVQRLEHDFKVTLQQQSSLDQWASWLDNVVTQVLKQHSGSPSFPKAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLVEHRVAQATGETPIAVMGEFNDLASLSLTLLDKEDIGDGHSSEADVDGRSLGEPLVKRERSDPSHPLQGI
• Sequence Length: 717

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Rfx2 recombinant protein

This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. This protein is structurally related to regulatory factors X1, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. This protein can bind to cis elements in the promoter of the IL-5 receptor alpha gene. Two transcript variants encoding different isoforms have been described for this gene, and both variants utilize alternative polyadenylation sites.

NCBI and Uniprot Product Information

• NCBI GI #: 6677731
• NCBI GeneID: 19725
• NCBI Accession #: NP_033082.1
• NCBI GenBank Nucleotide #: NM_009056.2
• UniProt Accession #: P48379; Q8BXR3
• Molecular Weight: 76,534 Da
• NCBI Official Full Name: DNA-binding protein RFX2 isoform 2
• NCBI Official Synonym Full Names: regulatory factor X, 2 (influences HLA class II expression)
• NCBI Official Symbol: Rfx2
• NCBI Official Synonym Symbols: 5430432H19Rik
• NCBI Protein Information: DNA-binding protein RFX2
• UniProt Protein Name: DNA-binding protein RFX2
• Protein Family: DNA-binding protein
• UniProt Gene Name: Rfx2

Uniprot Description

Transcription factor that acts as a key regulator of spermatogenesis (PubMed:26248850, PubMed:26162102, PubMed:26853561). Acts by regulating expression of genes required for the haploid phase during spermiogenesis, such as genes required for cilium assembly and function (PubMed:26162102, PubMed:26853561). Recognizes and binds the X-box, a regulatory motif with DNA sequence 5'-GTNRCC(0-3N)RGYAAC-3' present on promoters (PubMed:15229132, PubMed:26162102). Probably activates transcription of the testis-specific histone gene HIST1H1T (PubMed:15229132).