Heparin-binding growth factor 1 Recombinant Protein | FGF1 recombinant protein

Recombinant Human Heparin-binding growth factor 1

Cat. Num. AAA961749

• Gene Names: FGF1; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Heparin-binding growth factor 1; Recombinant Human Heparin-binding growth factor 1; Acidic fibroblast growth factor; aFGF; Endothelial cell growth factor; ECGF; HBGF-1; FGF1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 16-155aa; Full Length of Mature Protein
• Sequence: FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• Sequence Length: 155

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for FGF1 recombinant protein

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro.

Product Categories/Family for FGF1 recombinant protein

Signal Transduction

References

Human endothelial cell growth factor cloning, nucleotide sequence, and chromosome localization.Jaye M., Howk R., Burgess W., Ricca G.A., Chiu I.-M., Ravera M.W., O'Brien S.J., Modi W.S., Maciag T., Drohan W.N.Science 233:541-545(1986) Structural analysis of the gene for human acidic fibroblast growth factor.Mergia A., Tischer E., Graves D., Tumolo A., Miller J., Gospodarowicz D., Abraham J.A., Shipley G.D., Fiddes J.C.Biochem. Biophys. Res. Commun. 164:1121-1129(1989) Cloning of the gene coding for human class 1 heparin-binding growth factor and its expression in fetal tissues.Wang W.P., Lehtoma K., Varban M.L., Krishnan I., Chiu I.M.Mol. Cell. Biol. 9:2387-2395(1989) Alternative splicing generates two forms of mRNA coding for human heparin-binding growth factor 1.Chiu I.M., Wang W.P., Lehtoma K.Oncogene 5:755-762(1990) Cloning and sequence analysis of the human acidic fibroblast growth factor gene and its preservation in leukemia patients.Wang W.P., Quick D., Balcerzak S.P., Needleman S.W., Chiu I.M.Oncogene 6:1521-1529(1991) An acidic fibroblast growth factor protein generated by alternate splicing acts like an antagonist.Li Y.L., Kha H., Golden J.A., Migchielsen A.A.J., Goetzl E.J., Turck E.J.J. Exp. Med. 175:1073-1080(1992) The expression of acidic fibroblast growth factor (heparin-binding growth factor-1) and cytokine genes in human cardiac allografts and T cells.Zhao X.M., Yeoh T.K., Hiebert M., Frist W.H., Miller G.G.Transplantation 56:1177-1182(1993) NIEHS SNPs programComplete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence and comparative analysis of human chromosome 5.Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S., Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.Nature 431:268-274(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 4503697
• NCBI GeneID: 2246
• NCBI Accession #: NP_000791.1
• NCBI GenBank Nucleotide #: NM_000800.4
• UniProt Accession #: P05230; P07502; Q16588; B2R5T0; D3DQF2
• Molecular Weight: 31.8 kDa
• NCBI Official Full Name: fibroblast growth factor 1 isoform 1
• NCBI Official Synonym Full Names: fibroblast growth factor 1
• NCBI Official Symbol: FGF1
• NCBI Official Synonym Symbols: AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
• NCBI Protein Information: fibroblast growth factor 1
• UniProt Protein Name: Fibroblast growth factor 1
• Protein Family: Fibroblast growth factor
• UniProt Gene Name: FGF1
• UniProt Synonym Gene Names: FGFA; FGF-1; aFGF; ECGF; HBGF-1
• UniProt Entry Name: FGF1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]

Uniprot Description

FGF1: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors. Found in a complex with FGFBP1, FGF1 and FGF2. Interacts with FGFBP1. Part of a Cu(2+)-dependent multiprotein aggregate containing FGF1, S100A13 and SYT1. Interacts with SYT1. Interacts with S100A13. Belongs to the heparin-binding growth factors family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cytokine; Cell development/differentiation

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: cell cortex; cytosol; extracellular region; extracellular space; nucleolus; nucleoplasm; proteinaceous extracellular matrix

Molecular Function: fibroblast growth factor receptor binding; growth factor activity; heparin binding; Hsp70 protein binding; protein binding

Biological Process: activation of MAPKK activity; anatomical structure morphogenesis; angiogenesis; axon guidance; cell proliferation; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; induction of an organ; innate immune response; insulin receptor signaling pathway; lung development; MAPKKK cascade; multicellular organismal development; nerve growth factor receptor signaling pathway; phosphoinositide-mediated signaling; positive regulation of angiogenesis; positive regulation of cell division; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of cholesterol biosynthetic process; positive regulation of epithelial cell proliferation; positive regulation of MAP kinase activity; positive regulation of transcription from RNA polymerase II promoter; Ras protein signal transduction; signal transduction; small GTPase mediated signal transduction; vascular endothelial growth factor receptor signaling pathway