Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Dual specificity mitogen-activated protein kinase kinase 1 (Map2k1) Recombinant Protein | Map2k1 recombinant protein

Recombinant Mouse Dual specificity mitogen-activated protein kinase kinase 1 (Map2k1)

Gene Names
Map2k1; Mek1; MEKK1; MAPKK1; Prkmk1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dual specificity mitogen-activated protein kinase kinase 1 (Map2k1); Recombinant Mouse Dual specificity mitogen-activated protein kinase kinase 1 (Map2k1); Map2k1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-393, Full length protein
Sequence
PKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCHVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAASI
Sequence Length
392
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Map2k1 recombinant protein
This protein is a member of the dual specificity protein kinase family, which acts as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,474 Da
NCBI Official Full Name
dual specificity mitogen-activated protein kinase kinase 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase 1
NCBI Official Symbol
Map2k1
NCBI Official Synonym Symbols
Mek1; MEKK1; MAPKK1; Prkmk1
NCBI Protein Information
dual specificity mitogen-activated protein kinase kinase 1
UniProt Protein Name
Dual specificity mitogen-activated protein kinase kinase 1
UniProt Gene Name
Map2k1
UniProt Synonym Gene Names
Mek1; Prkmk1; MAP kinase kinase 1; MAPKK 1; MEK 1

Uniprot Description

Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Binding of extracellular ligands such as growth factors, cytokines and hormones to their cell-surface receptors activates RAS and this initiates RAF1 activation. RAF1 then further activates the dual-specificity protein kinases MAP2K1/MEK1 and MAP2K2/MEK2. Both MAP2K1/MEK1 and MAP2K2/MEK2 function specifically in the MAPK/ERK cascade, and catalyze the concomitant phosphorylation of a threonine and a tyrosine residue in a Thr-Glu-Tyr sequence located in the extracellular signal-regulated kinases MAPK3/ERK1 and MAPK1/ERK2, leading to their activation and further transduction of the signal within the MAPK/ERK cascade. Depending on the cellular context, this pathway mediates diverse biological functions such as cell growth, adhesion, survival and differentiation, predominantly through the regulation of transcription, metabolism and cytoskeletal rearrangements. One target of the MAPK/ERK cascade is peroxisome proliferator-activated receptor gamma (PPARG), a nuclear receptor that promotes differentiation and apoptosis. MAP2K1/MEK1 has been shown to export PPARG from the nucleus. The MAPK/ERK cascade is also involved in the regulation of endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC), as well as in the fragmentation of the Golgi apparatus during mitosis.

Research Articles on Map2k1

Similar Products

Product Notes

The Map2k1 map2k1 (Catalog #AAA960853) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-393, Full length protein. The amino acid sequence is listed below: PKKKPTPIQL NPAPDGSAVN GTSSAETNLE ALQKKLEELE LDEQQRKRLE AFLTQKQKVG ELKDDDFEKI SELGAGNGGV VFKVSHKPSG LVMARKLIHL EIKPAIRNQI IRELQVLHEC NSPYIVGFYG AFYSDGEISI CMEHMDGGSL DQVLKKAGRI PEQILGKVSI AVIKGLTYLR EKHKIMHRDV KPSNILVNSR GEIKLCDFGV SGQLIDSMAN SFVGTRSYMS PERLQGTHYS VQSDIWSMGL SLVEMAVGRY PIPPPDAKEL ELLFGCHVEG DAAETPPRPR TPGRPLSSYG MDSRPPMAIF ELLDYIVNEP PPKLPSGVFS LEFQDFVNKC LIKNPAERAD LKQLMVHAFI KRSDAEEVDF AGWLCSTIGL NQPSTPTHAA SI. It is sometimes possible for the material contained within the vial of "Dual specificity mitogen-activated protein kinase kinase 1 (Map2k1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.