Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

G protein-activated inward rectifier potassium channel 3 (Kcnj9) Recombinant Protein | Kcnj9 recombinant protein

Recombinant Mouse G protein-activated inward rectifier potassium channel 3 (Kcnj9)

Gene Names
Kcnj9; Girk3; Kir3.3; mbGIRK3; 1700085N21Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
G protein-activated inward rectifier potassium channel 3 (Kcnj9); Recombinant Mouse G protein-activated inward rectifier potassium channel 3 (Kcnj9); Recombinant G protein-activated inward rectifier potassium channel 3 (Kcnj9); G protein-activated inward rectifier potassium channel 3; GIRK-3; Inward rectifier K(+) channel Kir3.3 Potassium channel; inwardly rectifying subfamily J member 9; Kcnj9 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-393
Sequence
MAQENAAFSPGSEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGAGDGADKEHNGCLPPPESESKV
Sequence Length
393
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,974 Da
NCBI Official Full Name
G protein-activated inward rectifier potassium channel 3
NCBI Official Synonym Full Names
potassium inwardly-rectifying channel, subfamily J, member 9
NCBI Official Symbol
Kcnj9
NCBI Official Synonym Symbols
Girk3; Kir3.3; mbGIRK3; 1700085N21Rik
NCBI Protein Information
G protein-activated inward rectifier potassium channel 3; GIRK-3; inward rectifier K(+) channel Kir3.3; inwardly rectifier K(+) channel Kir3.3; potassium channel, inwardly rectifying subfamily J member 9
UniProt Protein Name
G protein-activated inward rectifier potassium channel 3
UniProt Gene Name
Kcnj9
UniProt Synonym Gene Names
Girk3; GIRK-3
UniProt Entry Name
IRK9_MOUSE

Uniprot Description

GIRK3: This receptor is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ9 subfamily.

Protein type: Membrane protein, multi-pass; Channel, potassium; Membrane protein, integral

Cellular Component: membrane; integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: G-protein activated inward rectifier potassium channel activity; voltage-gated ion channel activity; inward rectifier potassium channel activity; PDZ domain binding

Biological Process: potassium ion import; transport; ion transport; potassium ion transport

Research Articles on Kcnj9

Similar Products

Product Notes

The Kcnj9 kcnj9 (Catalog #AAA960614) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-393. The amino acid sequence is listed below: MAQENAAFSP GSEEPPRRRG RQRYVEKDGR CNVQQGNVRE TYRYLTDLFT TLVDLQWRLS LLFFVLAYAL TWLFFGAIWW LIAYGRGDLE HLEDTAWTPC VNNLNGFVAA FLFSIETETT IGYGHRVITD QCPEGIVLLL LQAILGSMVN AFMVGCMFVK ISQPNKRAAT LVFSSHAVVS LRDGRLCLMF RVGDLRSSHI VEASIRAKLI RSRQTLEGEF IPLHQTDLSV GFDTGDDRLF LVSPLVISHE IDAASPFWEA SRRALERDDF EIVVILEGMV EATGMTCQAR SSYLVDEVLW GHRFTSVLTL EDGFYEVDYA SFHETFEVPT PSCSARELAE AAARLDAHLY WSIPSRLDEK VEEEGAGEGA GAGDGADKEH NGCLPPPESE SKV. It is sometimes possible for the material contained within the vial of "G protein-activated inward rectifier potassium channel 3 (Kcnj9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual