Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PR domain zinc finger protein 16 (Prdm16) Recombinant Protein | Prdm16 recombinant protein

Recombinant Mouse PR domain zinc finger protein 16 (Prdm16) , partial

Gene Names
Prdm16; csp1; mel1; 5730557K01Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
PR domain zinc finger protein 16 (Prdm16); Recombinant Mouse PR domain zinc finger protein 16 (Prdm16); partial; Prdm16 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
680-1038aa; Partial
Sequence
EEQLLTASGAAGDSIKAIASIAEKYFGPGFMSMQEKKLGSLPYHSVFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPRDALKVGGPSAECPFDLTTKPKEAKPALLAPKVPLIPSSGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKPGVSEGLPKVCPAQLPQQPSLHYAKPSPFFMDPIYRVEKRKVADPVGVLKEKYLRPSPLLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKHEHEGAPVS
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Prdm16 recombinant protein
The reciprocal translocation t(1;3)(p36;q21) occurs in a subset of myelodysplastic syndrome (MDS) and acute myeloid leukemia (AML). This gene is located near the 1p36.3 breakpoint and has been shown to be specifically expressed in the t(1:3)(p36,q21)-positive MDS
AML. This protein is a zinc finger transcription factor and contains an N-terminal PR domain. The translocation results in the overexpression of a truncated version of this protein that lacks the PR domain, which may play an important role in the pathogenesis of MDS and AML. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
140,945 Da
NCBI Official Full Name
PR domain zinc finger protein 16 isoform 3
NCBI Official Synonym Full Names
PR domain containing 16
NCBI Official Symbol
Prdm16
NCBI Official Synonym Symbols
csp1; mel1; 5730557K01Rik
NCBI Protein Information
PR domain zinc finger protein 16
UniProt Protein Name
PR domain zinc finger protein 16
UniProt Gene Name
Prdm16
UniProt Synonym Gene Names
MDS1/EVI1-like gene 1

Uniprot Description

Binds DNA and functions as a transcriptional regulator. Functions in the differentiation of brown adipose tissue (BAT) which is specialized in dissipating chemical energy in the form of heat in response to cold or excess feeding while white adipose tissue (WAT) is specialized in the storage of excess energy and the control of systemic metabolism. Together with CEBPB, regulates the differentiation of myoblastic precursors into brown adipose cells. Functions also as a repressor of TGF-beta signaling. May regulate granulocytes differentiation.

Research Articles on Prdm16

Similar Products

Product Notes

The Prdm16 prdm16 (Catalog #AAA959824) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 680-1038aa; Partial. The amino acid sequence is listed below: EEQLLTASGA AGDSIKAIAS IAEKYFGPGF MSMQEKKLGS LPYHSVFPFQ FLPNFPHSLY PFTDRALAHN LLVKAEPKSP RDALKVGGPS AECPFDLTTK PKEAKPALLA PKVPLIPSSG EEQPLDLSIG SRARASQNGG GREPRKNHVY GERKPGVSEG LPKVCPAQLP QQPSLHYAKP SPFFMDPIYR VEKRKVADPV GVLKEKYLRP SPLLFHPQMS AIETMTEKLE SFAAMKADSG SSLQPLPHHP FNFRSPPPTL SDPILRKGKE RYTCRYCGKI FPRSANLTRH LRTHTGEQPY RCKYCDRSFS ISSNLQRHVR NIHNKEKPFK CHLCNRCFGQ QTNLDRHLKK HEHEGAPVS . It is sometimes possible for the material contained within the vial of "PR domain zinc finger protein 16 (Prdm16), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.