Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Delta-type opioid receptor (Oprd1) Recombinant Protein | Oprd1 recombinant protein

Recombinant Mouse Delta-type opioid receptor (Oprd1)

Gene Names
Oprd1; Nbor; mDOR; DOR-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Delta-type opioid receptor (Oprd1); Recombinant Mouse Delta-type opioid receptor (Oprd1); Recombinant Delta-type opioid receptor (Oprd1); Delta-type opioid receptor; D-OR-1; DOR-1; K56 MSL-2; Oprd1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-372
Sequence
MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTACTPSDGPGGGAAA
Sequence Length
372
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,561 Da
NCBI Official Full Name
delta-type opioid receptor
NCBI Official Synonym Full Names
opioid receptor, delta 1
NCBI Official Symbol
Oprd1
NCBI Official Synonym Symbols
Nbor; mDOR; DOR-1
NCBI Protein Information
delta-type opioid receptor; K56; MSL-2; D-OR-1; delta 1 opioid receptor
UniProt Protein Name
Delta-type opioid receptor
UniProt Gene Name
Oprd1
UniProt Synonym Gene Names
D-OR-1; DOR-1
UniProt Entry Name
OPRD_MOUSE

Uniprot Description

DOR-1: delta opioid receptor, a G-protein coupled receptor. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Highly stereoselective. Receptor for enkephalins.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Membrane protein, integral

Cellular Component: postsynaptic membrane; neuron projection; membrane; integral to plasma membrane; cytoplasm; integral to membrane; plasma membrane; nerve terminal; intrinsic to plasma membrane; vesicle; lipid raft

Molecular Function: G-protein coupled receptor activity; neuropeptide binding; signal transducer activity; opioid receptor activity

Biological Process: adult locomotory behavior; cellular response to stress; regulation of calcium ion transport; sensory perception of pain; signal transduction; positive regulation of peptidyl-serine phosphorylation; negative regulation of protein oligomerization; G-protein coupled receptor protein signaling pathway; synaptic transmission; regulation of mitochondrial membrane potential; neuropeptide signaling pathway; protein import into nucleus, translocation; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); regulation of sensory perception of pain; G-protein signaling, adenylate cyclase inhibiting pathway; dopamine receptor, adenylate cyclase activating pathway

Research Articles on Oprd1

Similar Products

Product Notes

The Oprd1 oprd1 (Catalog #AAA959721) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-372. The amino acid sequence is listed below: MELVPSARAE LQSSPLVNLS DAFPSAFPSA GANASGSPGA RSASSLALAI AITALYSAVC AVGLLGNVLV MFGIVRYTKL KTATNIYIFN LALADALATS TLPFQSAKYL METWPFGELL CKAVLSIDYY NMFTSIFTLT MMSVDRYIAV CHPVKALDFR TPAKAKLINI CIWVLASGVG VPIMVMAVTQ PRDGAVVCML QFPSPSWYWD TVTKICVFLF AFVVPILIIT VCYGLMLLRL RSVRLLSGSK EKDRSLRRIT RMVLVVVGAF VVCWAPIHIF VIVWTLVDIN RRDPLVVAAL HLCIALGYAN SSLNPVLYAF LDENFKRCFR QLCRTPCGRQ EPGSLRRPRQ ATTRERVTAC TPSDGPGGGA AA. It is sometimes possible for the material contained within the vial of "Delta-type opioid receptor (Oprd1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.