Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Isocitrate dehydrogenase [NADP], mitochondrial (Idh2) Recombinant Protein | Idh2 recombinant protein

Recombinant Mouse Isocitrate dehydrogenase [NADP], mitochondrial (Idh2)

Gene Names
Idh2; IDPm; Idh-2; E430004F23
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Isocitrate dehydrogenase [NADP]; mitochondrial (Idh2); Recombinant Mouse Isocitrate dehydrogenase [NADP]; Idh2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
40-452, Full length protein
Sequence
AEKRIKVEKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVVDRAGTFKLVFTPKDGSSAKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYSIQKKWPLYLSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVQTVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGKQ
Sequence Length
413
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Idh2 recombinant protein
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. This protein is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,906 Da
NCBI Official Full Name
isocitrate dehydrogenase
NCBI Official Synonym Full Names
isocitrate dehydrogenase 2 (NADP+), mitochondrial
NCBI Official Symbol
Idh2
NCBI Official Synonym Symbols
IDPm; Idh-2; E430004F23
NCBI Protein Information
isocitrate dehydrogenase [NADP], mitochondrial
UniProt Protein Name
Isocitrate dehydrogenase [NADP], mitochondrial
Protein Family
UniProt Gene Name
Idh2
UniProt Synonym Gene Names
IDH

Uniprot Description

Plays a role in intermediary metabolism and energy production. It may tightly associate or interact with the pyruvate dehydrogenase complex.

Research Articles on Idh2

Similar Products

Product Notes

The Idh2 idh2 (Catalog #AAA959598) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 40-452, Full length protein. The amino acid sequence is listed below: AEKRIKVEKP VVEMDGDEMT RIIWQFIKEK LILPHVDVQL KYFDLGLPNR DQTNDQVTID SALATQKYSV AVKCATITPD EARVEEFKLK KMWKSPNGTI RNILGGTVFR EPIICKNIPR LVPGWTKPIT IGRHAHGDQY KATDFVVDRA GTFKLVFTPK DGSSAKEWEV YNFPAGGVGM GMYNTDESIS GFAHSCFQYS IQKKWPLYLS TKNTILKAYD GRFKDIFQEI FDKHYKTDFD KNKIWYEHRL IDDMVAQVLK SSGGFVWACK NYDGDVQSDI LAQGFGSLGL MTSVLVCPDG KTIEAEAAHG TVTRHYREHQ KGRPTSTNPI ASIFAWTRGL EHRGKLDGNQ DLIRFAQTLE KVCVQTVESG AMTKDLAGCI HGLSNVKLNE HFLNTTDFLD TIKSNLDRAL GKQ. It is sometimes possible for the material contained within the vial of "Isocitrate dehydrogenase [NADP], mitochondrial (Idh2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.