Glutathione S-transferase Mu 2 (GSTM2) Recombinant Protein | GSTM2 recombinant protein

Recombinant Human Glutathione S-transferase Mu 2 (GSTM2)

Cat. Num. AAA959595

• Gene Names: GSTM2; GST4; GSTM; GTHMUS; GSTM2-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Glutathione S-transferase Mu 2 (GSTM2); Recombinant Human Glutathione S-transferase Mu 2 (GSTM2); GSTM2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-218, Full length protein
• Sequence: PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
• Sequence Length: 217

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for GSTM2 recombinant protein

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual s susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs.

NCBI and Uniprot Product Information

• NCBI GI #: 4504175
• NCBI GeneID: 2946
• NCBI Accession #: NP_000839.1
• NCBI GenBank Nucleotide #: NM_000848.3
• UniProt Accession #: P28161; Q2M318; Q5TZY5; Q8WWE1; B4DRY4; E9PEM9
• Molecular Weight: 22,644 Da
• NCBI Official Full Name: glutathione S-transferase Mu 2 isoform 1
• NCBI Official Synonym Full Names: glutathione S-transferase mu 2
• NCBI Official Symbol: GSTM2
• NCBI Official Synonym Symbols: GST4; GSTM; GTHMUS; GSTM2-2
• NCBI Protein Information: glutathione S-transferase Mu 2
• UniProt Protein Name: Glutathione S-transferase Mu 2
• Protein Family: Glutathione S-transferase
• UniProt Gene Name: GSTM2
• UniProt Synonym Gene Names: GST4

NCBI Description

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. [provided by RefSeq, Jul 2008]

Uniprot Description

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.