Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Fatty acid-binding protein, heart (Fabp3) Recombinant Protein | Fabp3 recombinant protein

Recombinant Rat Fatty acid-binding protein, heart (Fabp3)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fatty acid-binding protein; heart (Fabp3); Recombinant Rat Fatty acid-binding protein; Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP; Fabp3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-133. Full Length of Mature Protein
Sequence
ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Fabp3 recombinant protein
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Product Categories/Family for Fabp3 recombinant protein
References
"Cloning and tissue distribution of rat heart fatty acid binding protein mRNA: identical forms in heart and skeletal muscle." Claffey K.P., Herrera V.L., Brecher P., Ruiz-Opazo N. Biochemistry 26:7900-7904(1987)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.6 kDa
NCBI Official Full Name
fatty acid-binding protein, heart
NCBI Official Synonym Full Names
fatty acid binding protein 3
NCBI Official Symbol
Fabp3
NCBI Protein Information
fatty acid-binding protein, heart
UniProt Protein Name
Fatty acid-binding protein, heart
UniProt Gene Name
Fabp3
UniProt Synonym Gene Names
H-FABP
UniProt Entry Name
FABPH_RAT

NCBI Description

binds fatty acids; may play a role in fatty acid metabolism possibly including mitochondrial beta-oxidation of fatty acids [RGD, Feb 2006]

Uniprot Description

FABP3: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Protein type: Lipid-binding

Cellular Component: cytoplasm; cytosol; extracellular space; mitochondrion; sarcoplasm; sarcoplasmic reticulum

Molecular Function: cytoskeletal protein binding; fatty acid binding; icosatetraenoic acid binding; long-chain fatty acid transporter activity

Biological Process: cholesterol homeostasis; fatty acid beta-oxidation; fatty acid metabolic process; long-chain fatty acid transport; phospholipid homeostasis; regulation of fatty acid oxidation; response to drug; response to insulin stimulus

Research Articles on Fabp3

Similar Products

Product Notes

The Fabp3 fabp3 (Catalog #AAA959526) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-133. Full Length of Mature Protein. The amino acid sequence is listed below: ADAFVGTWKL VDSKNFDDYM KSLGVGFATR QVASMTKPTT IIEKNGDTIT IKTHSTFKNT EISFQLGVEF DEVTADDRKV KSVVTLDGGK LVHVQKWDGQ ETTLTRELSD GKLILTLTHG NVVSTRTYEK EA . It is sometimes possible for the material contained within the vial of "Fatty acid-binding protein, heart (Fabp3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.