Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CCL16 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellCCL16 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit anti-Human CCL16 Polyclonal Antibody | anti-CCL16 antibody

CCL16 antibody - N-terminal region

Gene Names
CCL16; LEC; LMC; NCC4; CKb12; HCC-4; LCC-1; Mtn-1; NCC-4; SCYL4; ILINCK; SCYA16
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCL16; Polyclonal Antibody; CCL16 antibody - N-terminal region; anti-CCL16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL
Sequence Length
120
Applicable Applications for anti-CCL16 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CCL16
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CCL16 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellCCL16 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-CCL16 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellCCL16 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-CCL16 antibody
This is a rabbit polyclonal antibody against CCL16. It was validated on Western Blot

Target Description: CCL16 gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. CCL16 displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10.
Product Categories/Family for anti-CCL16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
C-C motif chemokine 16
NCBI Official Synonym Full Names
C-C motif chemokine ligand 16
NCBI Official Symbol
CCL16
NCBI Official Synonym Symbols
LEC; LMC; NCC4; CKb12; HCC-4; LCC-1; Mtn-1; NCC-4; SCYL4; ILINCK; SCYA16
NCBI Protein Information
C-C motif chemokine 16
UniProt Protein Name
C-C motif chemokine 16
Protein Family
UniProt Gene Name
CCL16
UniProt Synonym Gene Names
ILINCK; NCC4; SCYA16; HCC-4; LMC; MTN-1
UniProt Entry Name
CCL16_HUMAN

NCBI Description

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10. [provided by RefSeq, Jul 2008]

Uniprot Description

CCL16: Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Motility/polarity/chemotaxis; Chemokine; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: extracellular space; extracellular region

Molecular Function: chemokine activity; chemoattractant activity

Biological Process: cell-cell signaling; positive chemotaxis; cell communication; immune response; chemotaxis; inflammatory response

Research Articles on CCL16

Similar Products

Product Notes

The CCL16 ccl16 (Catalog #AAA3200291) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCL16 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCL16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCL16 ccl16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLLVLILIIT SASRSQPKVP EWVNTPSTCC LKYYEKVLPR RLVVGYRKAL. It is sometimes possible for the material contained within the vial of "CCL16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.