Glutathione S-transferase omega-1 (GSTO1) Recombinant Protein | GSTO1 recombinant protein
Recombinant Human Glutathione S-transferase omega-1 (GSTO1)
Gene Names
GSTO1; P28; SPG-R; GSTO 1-1; GSTTLp28; HEL-S-21
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutathione S-transferase omega-1 (GSTO1); Recombinant Human Glutathione S-transferase omega-1 (GSTO1); GSTO1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-241, Full length protein
Sequence
SGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Sequence Length
240
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GSTO1 recombinant protein
This gene encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,796 Da
NCBI Official Full Name
glutathione S-transferase omega-1 isoform 2
NCBI Official Synonym Full Names
glutathione S-transferase omega 1
NCBI Official Symbol
GSTO1
NCBI Official Synonym Symbols
P28; SPG-R; GSTO 1-1; GSTTLp28; HEL-S-21
NCBI Protein Information
glutathione S-transferase omega-1
UniProt Protein Name
Glutathione S-transferase omega-1
Protein Family
UniProt Gene Name
GSTO1
UniProt Synonym Gene Names
GSTTLP28; MMA(V) reductase; SPG-R
NCBI Description
The protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded protein acts as a homodimer and is found in the cytoplasm. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010]
Uniprot Description
Exhibits glutathione-dependent thiol transferase and dehydroascorbate reductase activities. Has S-(phenacyl)glutathione reductase activity. Has also glutathione S-transferase activity. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA) and dimethylarsonic acid.
Research Articles on GSTO1
Similar Products
Product Notes
The GSTO1 gsto1 (Catalog #AAA958990) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-241, Full length protein. The amino acid sequence is listed below: SGESARSLGK GSAPPGPVPE GSIRIYSMRF CPFAERTRLV LKAKGIRHEV ININLKNKPE WFFKKNPFGL VPVLENSQGQ LIYESAITCE YLDEAYPGKK LLPDDPYEKA CQKMILELFS KVPSLVGSFI RSQNKEDYAG LKEEFRKEFT KLEEVLTNKK TTFFGGNSIS MIDYLIWPWF ERLEAMKLNE CVDHTPKLKL WMAAMKEDPT VSALLTSEKD WQGFLELYLQ NSPEACDYGL. It is sometimes possible for the material contained within the vial of "Glutathione S-transferase omega-1 (GSTO1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
