High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) Recombinant Protein | FCER1A recombinant protein

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial

Cat. Num. AAA958763

• Gene Names: FCER1A; FCE1A; FcERI
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A); Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A); partial; High affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; FcERI; IgE Fc receptor subunit alpha; FCER1A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 26-205. Partial, provide the complete extracellular domain.
• Sequence: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for FCER1A recombinant protein

Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.

Product Categories/Family for FCER1A recombinant protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 4503675
• NCBI GeneID: 2205
• NCBI Accession #: NP_001992.1
• NCBI GenBank Nucleotide #: NM_002001.3
• UniProt Accession #: P12319
• Molecular Weight: 23 kDa
• NCBI Official Full Name: high affinity immunoglobulin epsilon receptor subunit alpha
• NCBI Official Synonym Full Names: Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
• NCBI Official Symbol: FCER1A
• NCBI Official Synonym Symbols: FCE1A; FcERI
• NCBI Protein Information: high affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; Fc epsilon RI alpha-chain; igE Fc receptor subunit alpha; Fc IgE receptor, alpha polypeptide; high affinity immunoglobulin epsilon receptor alpha-subunit; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide
• UniProt Protein Name: High affinity immunoglobulin epsilon receptor subunit alpha
• Protein Family: High affinity immunoglobulin epsilon receptor
• UniProt Gene Name: FCER1A
• UniProt Synonym Gene Names: FCE1A; FcERI
• UniProt Entry Name: FCERA_HUMAN

NCBI Description

The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy symptoms are released. This receptor is comprised of an alpha subunit, a beta subunit, and two gamma subunits. The protein encoded by this gene represents the alpha subunit. [provided by RefSeq, Aug 2011]

Uniprot Description

Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.