Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Substance-K receptor (Tacr2) Recombinant Protein | Tacr2 recombinant protein

Recombinant Mouse Substance-K receptor (Tacr2)

Gene Names
Tacr2; Skr; Nk2r; Tac2r
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Substance-K receptor (Tacr2); Recombinant Mouse Substance-K receptor (Tacr2); Recombinant Substance-K receptor (Tacr2); Substance-K receptor; SKR; NK-2 receptor; NK-2R Neurokinin A receptor Tachykinin receptor 2; Tacr2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-384
Sequence
MGAHASVTDTNILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTGNATVIWIILAHERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGSTFCYFQNLFPVTAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAVIWLVALALASPQCFYSTITVDQGATKCVVAWPNDNGGKMLLLYHLVVFVLIYFLPLVVMFAAYSVIGLTLWKRAVPRHQAHGANLRHLQAKKKFVKAMVLVVVTFAICWLPYHLYFILGTFQEDIYYRKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWGTPTEEDRLELTHTPSISRRVNRCHTKETLFMTGDMTHSEATNGQVGGPQDGEPAGP
Sequence Length
384
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,114 Da
NCBI Official Full Name
substance-K receptor
NCBI Official Synonym Full Names
tachykinin receptor 2
NCBI Official Symbol
Tacr2
NCBI Official Synonym Symbols
Skr; Nk2r; Tac2r
NCBI Protein Information
substance-K receptor; NK-2R; NK-2 receptor; substance K receptor; neurokinin A receptor; 7 transmembrane receptor; tachykinin NK-2 receptor
UniProt Protein Name
Substance-K receptor
Protein Family
UniProt Gene Name
Tacr2
UniProt Synonym Gene Names
Tac2r; SKR; NK-2R
UniProt Entry Name
NK2R_MOUSE

Uniprot Description

TACR2: This is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance K > neuromedin-K > substance P. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; GPCR, family 1; Motility/polarity/chemotaxis; Membrane protein, multi-pass; Membrane protein, integral

Cellular Component: membrane; cell; plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; substance K receptor activity; signal transducer activity; tachykinin receptor activity

Biological Process: synaptic transmission; G-protein coupled receptor protein signaling pathway; negative regulation of luteinizing hormone secretion; tachykinin signaling pathway; intestine smooth muscle contraction; neuropeptide signaling pathway; operant conditioning; positive regulation of ion transport; signal transduction; positive regulation of vascular permeability; positive regulation of acetylcholine secretion

Research Articles on Tacr2

Similar Products

Product Notes

The Tacr2 tacr2 (Catalog #AAA957353) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-384. The amino acid sequence is listed below: MGAHASVTDT NILSGLESNA TGVTAFSMPG WQLALWATAY LALVLVAVTG NATVIWIILA HERMRTVTNY FIINLALADL CMAAFNATFN FIYASHNIWY FGSTFCYFQN LFPVTAMFVS IYSMTAIAAD RYMAIVHPFQ PRLSAPSTKA VIAVIWLVAL ALASPQCFYS TITVDQGATK CVVAWPNDNG GKMLLLYHLV VFVLIYFLPL VVMFAAYSVI GLTLWKRAVP RHQAHGANLR HLQAKKKFVK AMVLVVVTFA ICWLPYHLYF ILGTFQEDIY YRKFIQQVYL ALFWLAMSST MYNPIIYCCL NHRFRSGFRL AFRCCPWGTP TEEDRLELTH TPSISRRVNR CHTKETLFMT GDMTHSEATN GQVGGPQDGE PAGP. It is sometimes possible for the material contained within the vial of "Substance-K receptor (Tacr2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.