Calreticulin (Calr) Recombinant Protein | Calr recombinant protein

Recombinant Mouse Calreticulin (Calr)

Cat. Num. AAA957196

• Gene Names: Calr; CRT; Calregulin
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Calreticulin (Calr); Recombinant Mouse Calreticulin (Calr); CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP; Calr recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 18-416aa; Full Length of Mature Protein
• Sequence: DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

• Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for Calr recombinant protein

Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis.

References

Multiple zones in the sequence of calreticulin (CRP55, calregulin, HACBP) , a major calcium binding ER/SR protein.Smith M.J., Koch G.L.E.EMBO J. 8:3581-3586(1989) Determination of the sequence of an expressible cDNA clone encoding ERp60/calregulin by the use of a novel nested set method.Mazzarella R.A., Gold P., Cunningham M., Green M.Gene 120:217-225(1992) Separation and sequencing of familiar and novel murine proteins using preparative two-dimensional gel electrophoresis.Merrick B.A., Patterson R.M., Wichter L.L., He C., Selkirk J.K.Electrophoresis 15:735-745(1994) Lubec G., Kang S.U., Sunyer B., Chen W.-Q.Submitted (JAN-2009) to UniProtKB The calcium-binding protein calreticulin is a major constituent of lytic granules in cytolytic T lymphocytes.Dupuis M., Schaerer E., Krause K.-H., Tschopp J.J. Exp. Med. 177:1-7(1993) Age-specific CUGBP1-eIF2 complex increases translation of CCAAT/enhancer-binding protein beta in old liver.Timchenko L.T., Salisbury E., Wang G.-L., Nguyen H., Albrecht J.H., Hershey J.W., Timchenko N.A.J. Biol. Chem. 281:32806-32819(2006) Structural basis of cyclophilin B binding by the calnexin/calreticulin P-domain.Kozlov G., Bastos-Aristizabal S., Maattanen P., Rosenauer A., Zheng F., Killikelly A., Trempe J.F., Thomas D.Y., Gehring K.J. Biol. Chem. 285:35551-35557(2010) A mouse protein that localizes to acrosome and sperm tail is regulated by Y-chromosome.Bhattacharya R., Devi M.S., Dhople V.M., Jesudasan R.A.BMC Cell Biol. 14:50-50(2013) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013) Structural basis of carbohydrate recognition by calreticulin.Kozlov G., Pocanschi C.L., Rosenauer A., Bastos-Aristizabal S., Gorelik A., Williams D.B., Gehring K.J. Biol. Chem. 285:38612-38620(2010) Structural and functional relationships between the lectin and arm domains of calreticulin.Pocanschi C.L., Kozlov G., Brockmeier U., Brockmeier A., Williams D.B., Gehring K.J. Biol. Chem. 286:27266-27277(2011)

NCBI and Uniprot Product Information

• NCBI GI #: 6680836
• NCBI GeneID: 12317
• NCBI Accession #: NP_031617.1
• NCBI GenBank Nucleotide #: NM_007591.3
• UniProt Accession #: P14211; Q3TVD2
• Molecular Weight: 48.3 kDa
• NCBI Official Full Name: calreticulin
• NCBI Official Synonym Full Names: calreticulin
• NCBI Official Symbol: Calr
• NCBI Official Synonym Symbols: CRT; Calregulin
• NCBI Protein Information: calreticulin
• UniProt Protein Name: Calreticulin
• UniProt Gene Name: Calr
• UniProt Synonym Gene Names: ERp60
• UniProt Entry Name: CALR_MOUSE

Uniprot Description

Calreticulin: Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis. Monomer. Component of an EIF2 complex at least composed of CELF1/CUGBP1, CALR, CALR3, EIF2S1, EIF2S2, HSP90B1 and HSPA5. Interacts with PDIA3/ERp57. Interacts with NR3C1 and TRIM21. Interacts with GABARAP. Belongs to the calreticulin family.

Protein type: Motility/polarity/chemotaxis; Calcium-binding; Secreted; Nuclear receptor co-regulator; Secreted, signal peptide

Cellular Component: acrosome; cell surface; cytoplasm; cytosol; endoplasmic reticulum; endoplasmic reticulum lumen; external side of plasma membrane; extracellular matrix; extracellular space; focal adhesion; Golgi apparatus; intracellular membrane-bound organelle; membrane; nucleus; perinuclear region of cytoplasm; polysome; protein complex; sarcoplasmic reticulum; smooth endoplasmic reticulum

Molecular Function: androgen receptor binding; calcium ion binding; carbohydrate binding; glycoprotein binding; hormone binding; integrin binding; iron ion binding; metal ion binding; mRNA binding; peptide binding; protein binding; ubiquitin protein ligase binding; unfolded protein binding

Biological Process: cell cycle arrest; cortical actin cytoskeleton organization and biogenesis; negative regulation of neuron differentiation; negative regulation of retinoic acid receptor signaling pathway; negative regulation of steroid hormone receptor signaling pathway; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of translation; peptide antigen assembly with MHC class I protein complex; positive regulation of cell cycle; positive regulation of cell proliferation; positive regulation of DNA replication; positive regulation of phagocytosis; protein export from nucleus; protein folding; protein stabilization; regulation of meiosis