Glandular kallikrein-10 (Klk10) Recombinant Protein | Klk10 recombinant protein
Recombinant Rat Glandular kallikrein-10 (Klk10)
Gene Names
Klk1c10; Klk10; rGK-10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glandular kallikrein-10 (Klk10); Recombinant Rat Glandular kallikrein-10 (Klk10); Klk10 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-259, Full length protein
Sequence
IVGGYKCEKNSQPWQVAIINEYLCGGVLIDPSWVITAAHCYSNYYHVLLGRNNLFEDEPFAQYRFVNQSFPHPDYKPFLMRNHTRQRGDDYSNDLMLLHLSEPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLNWELPDDLQCVNIHLLSNEKCIEAYEQKVTDLMLCAGEMDGRKDTCKGDSGGPLICDGVLQGITSWGNVPCAEPYNPGVYTKLIKFTSWIKEVMKENP
Sequence Length
235
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Klk10 recombinant protein
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,981 Da
NCBI Official Full Name
glandular kallikrein-10
NCBI Official Synonym Full Names
kallikrein 1-related peptidase C10
NCBI Official Symbol
Klk1c10
NCBI Official Synonym Symbols
Klk10; rGK-10
NCBI Protein Information
glandular kallikrein-10
UniProt Protein Name
Glandular kallikrein-10
Protein Family
UniProt Gene Name
Klk10
UniProt Synonym Gene Names
Klk-10; K10; rGK-10
Uniprot Description
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. This protein may be involved in the regulation of renal function.
Similar Products
Product Notes
The Klk10 klk10 (Catalog #AAA956878) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-259, Full length protein. The amino acid sequence is listed below: IVGGYKCEKN SQPWQVAIIN EYLCGGVLID PSWVITAAHC YSNYYHVLLG RNNLFEDEPF AQYRFVNQSF PHPDYKPFLM RNHTRQRGDD YSNDLMLLHL SEPADITDGV KVIDLPTEEP KVGSTCLASG WGSTKPLNWE LPDDLQCVNI HLLSNEKCIE AYEQKVTDLM LCAGEMDGRK DTCKGDSGGP LICDGVLQGI TSWGNVPCAE PYNPGVYTKL IKFTSWIKEV MKENP. It is sometimes possible for the material contained within the vial of "Glandular kallikrein-10 (Klk10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
