Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (KLK10 monoclonal antibody Western Blot analysis of KLK10 expression in A-431.)

Mouse anti-Human Kallikrein 10 Monoclonal Antibody | anti-KLK10 antibody

Kallikrein 10 (KLK10, Kallikrein-related Peptidase 10, Normal Epithelial Cell-specific 1, NES1, Protease Serine-like 1, PRSSL1) (HRP)

Gene Names
KLK10; NES1; PRSSL1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Kallikrein 10; Monoclonal Antibody; Kallikrein 10 (KLK10; Kallikrein-related Peptidase 10; Normal Epithelial Cell-specific 1; NES1; Protease Serine-like 1; PRSSL1) (HRP); anti-KLK10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1, lambda
Clone Number
1G8
Specificity
Recognizes human KLK10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-KLK10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa167-277, from human KLK10 (NP_002767) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(KLK10 monoclonal antibody Western Blot analysis of KLK10 expression in A-431.)

Western Blot (WB) (KLK10 monoclonal antibody Western Blot analysis of KLK10 expression in A-431.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to KLK10 on A-431 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to KLK10 on A-431 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged KLK10 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KLK10 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-KLK10 antibody
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. KLK10 is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers.
Product Categories/Family for anti-KLK10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
kallikrein-10 preproprotein
NCBI Official Synonym Full Names
kallikrein related peptidase 10
NCBI Official Symbol
KLK10
NCBI Official Synonym Symbols
NES1; PRSSL1
NCBI Protein Information
kallikrein-10
UniProt Protein Name
Kallikrein-10
Protein Family
UniProt Gene Name
KLK10
UniProt Synonym Gene Names
NES1; PRSSL1
UniProt Entry Name
KLK10_HUMAN

NCBI Description

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

KLK10: Has a tumor-suppressor role for NES1 in breast and prostate cancer. Belongs to the peptidase S1 family. Kallikrein subfamily.

Protein type: Tumor suppressor; Secreted; Secreted, signal peptide; EC 3.4.21.-; Protease

Chromosomal Location of Human Ortholog: 19q13

Cellular Component: extracellular region

Molecular Function: serine-type peptidase activity; serine-type endopeptidase activity

Biological Process: proteolysis; cell cycle

Research Articles on KLK10

Similar Products

Product Notes

The KLK10 klk10 (Catalog #AAA6153160) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Kallikrein 10 (KLK10, Kallikrein-related Peptidase 10, Normal Epithelial Cell-specific 1, NES1, Protease Serine-like 1, PRSSL1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Kallikrein 10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLK10 klk10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Kallikrein 10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.