Cytochrome P450 2C18 (CYP2C18) Recombinant Protein | CYP2C18 recombinant protein

Recombinant Human Cytochrome P450 2C18 (CYP2C18)

Cat. Num. AAA956751

• Gene Names: CYP2C18; CPCI; CYP2C; CYP2C17; P450IIC17; P450-6B/29C
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cytochrome P450 2C18 (CYP2C18); Recombinant Human Cytochrome P450 2C18 (CYP2C18); CYP2C18 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-490, Full length protein
• Sequence: MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYIKSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYIDLLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFKKSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV
• Sequence Length: 490

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for CYP2C18 recombinant protein

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum but its specific substrate has not yet been determined. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. An additional gene, CYP2C17, was once thought to exist; however, CYP2C17 is now considered an artefact based on a chimera of CYP2C18 and CYP2C19. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 13699816
• NCBI GeneID: 1562
• NCBI Accession #: NP_000763.1
• NCBI GenBank Nucleotide #: NM_000772.2
• UniProt Accession #: P33260; Q16703; Q16751; Q4VAT5; Q6GRG1; B2R8K2
• Molecular Weight: 48,805 Da
• NCBI Official Full Name: cytochrome P450 2C18 isoform 1
• NCBI Official Synonym Full Names: cytochrome P450 family 2 subfamily C member 18
• NCBI Official Symbol: CYP2C18
• NCBI Official Synonym Symbols: CPCI; CYP2C; CYP2C17; P450IIC17; P450-6B/29C
• NCBI Protein Information: cytochrome P450 2C18
• UniProt Protein Name: Cytochrome P450 2C18
• Protein Family: Cytochrome
• UniProt Gene Name: CYP2C18

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum but its specific substrate has not yet been determined. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. An additional gene, CYP2C17, was once thought to exist; however, CYP2C17 is now considered an artefact based on a chimera of CYP2C18 and CYP2C19. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.