(Rhesus macaque) C-C chemokine receptor type 5 (CCR5) Recombinant Protein | CCR5 recombinant protein

Recombinant Macaca mulatta (Rhesus macaque) C-C chemokine receptor type 5 (CCR5)

Cat. Num. AAA956064

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: (Rhesus macaque) C-C chemokine receptor type 5 (CCR5); Recombinant Macaca mulatta (Rhesus macaque) C-C chemokine receptor type 5 (CCR5); Recombinant (Rhesus macaque) C-C chemokine receptor type 5 (CCR5); C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; CCR5; CD_antigen= CD195; CCR5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-352
• Sequence: MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKRLKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSSHFPYSQYQFWKNFQTLKMVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
• Sequence Length: 352

• Species: Macaca mulatta (Rhesus macaque)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 116812907
• NCBI GeneID: 735311
• NCBI Accession #: NP_001036238.2
• NCBI GenBank Nucleotide #: NM_001042773.2
• UniProt Accession #: P61813; O02746; P79436
• Molecular Weight: 40,507 Da
• NCBI Official Full Name: C-C chemokine receptor type 5
• NCBI Official Symbol: CCR5
• NCBI Protein Information: C-C chemokine receptor type 5; CCR-5; CC-CKR-5; C-C CKR-5; CC chemokine receptor 5
• UniProt Protein Name: C-C chemokine receptor type 5
• Protein Family: C-C chemokine receptor
• UniProt Gene Name: CCR5
• UniProt Synonym Gene Names: CMKBR5; C-C CKR-5; CC-CKR-5; CCR-5; CCR5
• UniProt Entry Name: CCR5_MACMU

Uniprot Description

Function: Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation

By similarity.

Subunit structure: Interacts with PRAF2. Efficient ligand binding to CCL3/MIP-1alpha and CCL4/MIP-1beta requires sulfation, O-glycosylation and sialic acid modifications. Glycosylation on Ser-6 is required for efficient binding of CCL4. Interacts with ADRBK1. Interacts with ARRB1 and ARRB2

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein.

Post-translational modification: Sulfated on at least 2 of the N-terminal tyrosines. Sulfation is required for efficient binding of the chemokines, CCL3 and CCL4

By similarity.O-glycosylated, but not N-glycosylated. Ser-6 appears to be the major site. Also sialylated glycans present which contribute to chemokine binding. Thr-16 and Ser-17 may also be glycosylated and, if so, with small moieties such as a T-antigen

By similarity.Palmitoylation in the C-terminal is important for cell surface expression

By similarity.Phosphorylation on serine residues in the C-terminal is stimulated by binding CC chemokines especially by APO-RANTES

By similarity.

Sequence similarities: Belongs to the G-protein coupled receptor 1 family.