Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein Wnt-11 (WNT11) Recombinant Protein | WNT11 recombinant protein

Recombinant Chicken Protein Wnt-11 (WNT11)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein Wnt-11 (WNT11); Recombinant Chicken Protein Wnt-11 (WNT11); Recombinant Protein Wnt-11 (WNT11); Protein Wnt-11; WNT11 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-354aa; Full length protein
Sequence
IKWIALSKTPSSLALNQTQHCKQLEGLVVSQVQLCRSNLELMQTIIQAAREVIKTCRKTF SDMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHTIARACTTGDLPGCSCGPIP GETPGPGYRWGGCADNLNYGLIMGSKFSDAPMKMKKSGSQANKLMHLHNSEVGRQVLKAS LEMKCKCHGVSGSCSIKTCWKGLQELRDIALDLKNKYLSATKVVHRPMGTRKYLVPKDID IRPVKETELIYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYMDK VVERCHCKYHWCCYVTCKKCERTVERYVCK
Sequence Length
354
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for WNT11 recombinant protein
The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 97%, 85%, and 63% amino acid identity with mouse, chicken, and Xenopus Wnt11 protein, respectively. This gene may play roles in the development of skeleton, kidney and lung, and is considered to be a plausible candidate gene for High Bone Mass Syndrome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,507 Da
NCBI Official Full Name
protein Wnt-11
NCBI Official Synonym Full Names
wingless-type MMTV integration site family, member 11
NCBI Official Symbol
WNT11
NCBI Protein Information
protein Wnt-11; Wnt-11 protein
UniProt Protein Name
Protein Wnt-11
Protein Family
UniProt Gene Name
WNT11
UniProt Synonym Gene Names
WNT-11
UniProt Entry Name
WNT11_CHICK

Uniprot Description

Function: Ligand for members of the frizzled family of seven transmembrane receptors. May play a role in the formation of dermal structure, both limb and feather buds. Is likely to signal over only few cell diameters.

Subcellular location: Secreted › extracellular space › extracellular matrix.

Tissue specificity: Expressed in the dermatome. The expression domain is mutually exclusive to the other Wnt genes.

Developmental stage: Expressed during embryogenesis.

Post-translational modification: Palmitoylation at Ser-215 is required for efficient binding to frizzled receptors. It is also required for subsequent palmitoylation at Cys-80. Palmitoylation is necessary for proper trafficking to cell surface

By similarity.

Sequence similarities: Belongs to the Wnt family.

Research Articles on WNT11

Similar Products

Product Notes

The WNT11 wnt11 (Catalog #AAA955618) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-354aa; Full length protein. The amino acid sequence is listed below: IKWIALSKTP SSLALNQTQH CKQLEGLVVS QVQLCRSNLE LMQTIIQAAR EVIKTCRKTF SDMRWNCSSI ELAPNYLLDL ERGTRESAFV YALSAAAISH TIARACTTGD LPGCSCGPIP GETPGPGYRW GGCADNLNYG LIMGSKFSDA PMKMKKSGSQ ANKLMHLHNS EVGRQVLKAS LEMKCKCHGV SGSCSIKTCW KGLQELRDIA LDLKNKYLSA TKVVHRPMGT RKYLVPKDID IRPVKETELI YLQSSPDFCM KNEKVGSHGT QDRQCNKTSN GSDSCDLMCC GRGYNPYMDK VVERCHCKYH WCCYVTCKKC ERTVERYVCK. It is sometimes possible for the material contained within the vial of "Protein Wnt-11 (WNT11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.