Contactin-associated protein 1 Recombinant Protein | CNTNAP1 recombinant protein

Recombinant Human Contactin-associated protein 1

Cat. Num. AAA955441

• Gene Names: CNTNAP1; P190; CASPR; NRXN4; CNTNAP
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Contactin-associated protein 1; Recombinant Human Contactin-associated protein 1; Neurexin IVNeurexin-4p190; CNTNAP1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 26-356aa; Partial
• Sequence: DEELVGPLYARSLGASSYYSLLTAPRFARLHGISGWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNSTFFGNVNESAVVRHDLHFHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKADILYFDGDDAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELEGAHLLLHMSLGSSPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLDGYVQRFILNGDFERLNLDTEMFIGGLVGAARKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCL
• Sequence Length: 1384

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CNTNAP1 recombinant protein

Ses to play a role in the formation of functional distinct domains critical for saltatory conduction of nerve impulses in myelinated nerve fibers. Ses to darcate the paranodal region of the axo-glial junction. In association with contactin may have a role in the signaling between axons and myelinating glial cells.

Product Categories/Family for CNTNAP1 recombinant protein

Neuroscience

References

Identification of a novel contactin-associated transmembrane receptor with multiple domains implicated in protein-protein interactions.Peles E., Nativ M., Lustig M., Grumet M., Schilling J., Martinez R., Plowman G.D., Schlessinger J.EMBO J. 16:978-988(1997)

NCBI and Uniprot Product Information

• NCBI GI #: 4505463
• NCBI GeneID: 8506
• NCBI Accession #: NP_003623.1
• NCBI GenBank Nucleotide #: NM_003632.2
• UniProt Accession #: P78357
• Molecular Weight: 53.8 kDa
• NCBI Official Full Name: contactin-associated protein 1
• NCBI Official Synonym Full Names: contactin associated protein 1
• NCBI Official Symbol: CNTNAP1
• NCBI Official Synonym Symbols: P190; CASPR; NRXN4; CNTNAP
• NCBI Protein Information: contactin-associated protein 1
• UniProt Protein Name: Contactin-associated protein 1
• Protein Family: Contactin-associated protein
• UniProt Gene Name: CNTNAP1
• UniProt Synonym Gene Names: CASPR; NRXN4; Caspr; Caspr1
• UniProt Entry Name: CNTP1_HUMAN

NCBI Description

The gene product was initially identified as a 190-kD protein associated with the contactin-PTPRZ1 complex. The 1,384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain. Northern blot analysis showed that the gene is transcribed predominantly in brain as a transcript of 6.2 kb, with weak expression in several other tissues tested. The architecture of its extracellular domain is similar to that of neurexins, and this protein may be the signaling subunit of contactin, enabling recruitment and activation of intracellular signaling pathways in neurons. [provided by RefSeq, Jan 2009]

Uniprot Description

CNTNAP1: Seems to play a role in the formation of functional distinct domains critical for saltatory conduction of nerve impulses in myelinated nerve fibers. Seems to demarcate the paranodal region of the axo-glial junction. In association with contactin may have a role in the signaling between axons and myelinating glial cells. Belongs to the neurexin family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: integral to membrane; integral to plasma membrane; myelin sheath; paranode region of axon; voltage-gated potassium channel complex

Molecular Function: protein binding; receptor activity; SH3 domain binding; SH3/SH2 adaptor activity

Biological Process: action potential propagation; axon guidance; cell adhesion; cytoskeleton organization and biogenesis; neurite morphogenesis; neuromuscular process controlling balance; neuromuscular process controlling posture; paranodal junction assembly; positive regulation of signal transduction; signal transduction

Disease: Lethal Congenital Contracture Syndrome 7