Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Versican core protein (VCAN), partial Recombinant Protein | VCAN recombinant protein

Recombinant Human Versican core protein (VCAN), partial

Gene Names
VCAN; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Versican core protein (VCAN); partial; Recombinant Human Versican core protein (VCAN); Versican core protein; Chondroitin sulfate proteoglycan core protein 2; Chondroitin sulfate proteoglycan 2; Glial hyaluronate-binding protein; GHAP; Large fibroblast proteoglycan; PG-M; VCAN recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
3089-3354aa; Partial
Sequence
GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for VCAN recombinant protein
May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Product Categories/Family for VCAN recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
369,688 Da
NCBI Official Full Name
versican core protein isoform 2
NCBI Official Synonym Full Names
versican
NCBI Official Symbol
VCAN
NCBI Official Synonym Symbols
WGN; ERVR; GHAP; PG-M; WGN1; CSPG2
NCBI Protein Information
versican core protein; versican proteoglycan; large fibroblast proteoglycan; glial hyaluronate-binding protein; chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan core protein 2
UniProt Protein Name
Versican core protein
Protein Family
UniProt Gene Name
VCAN
UniProt Synonym Gene Names
CSPG2; Chondroitin sulfate proteoglycan 2; GHAP
UniProt Entry Name
CSPG2_HUMAN

NCBI Description

This gene is a member of the aggrecan/versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009]

Uniprot Description

CSPG2: May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid. Defects in VCAN are the cause of Wagner syndrome type 1 (WGN1). WGN is a dominantly inherited vitreoretinopathy characterized by an optically empty vitreous cavity with fibrillary condensations and a preretinal avascular membrane. Other optical features include progressive chorioretinal atrophy, perivascular sheating, subcapsular cataract and myopia. Systemic manifestations are absent in WGN. Belongs to the aggrecan/versican proteoglycan family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Secreted; Secreted, signal peptide; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 5q14.3

Cellular Component: extracellular matrix; proteinaceous extracellular matrix; extracellular space; lysosomal lumen; membrane; intracellular membrane-bound organelle; Golgi lumen; extracellular region

Molecular Function: protein binding; glycosaminoglycan binding; extracellular matrix structural constituent; hyaluronic acid binding; calcium ion binding; carbohydrate binding

Biological Process: extracellular matrix organization and biogenesis; chondroitin sulfate biosynthetic process; central nervous system development; glycosaminoglycan metabolic process; heart development; multicellular organismal development; pathogenesis; cell recognition; glial cell migration; dermatan sulfate biosynthetic process; chondroitin sulfate metabolic process; osteoblast differentiation; carbohydrate metabolic process; chondroitin sulfate catabolic process; cell adhesion; skeletal development

Disease: Wagner Vitreoretinopathy

Research Articles on VCAN

Similar Products

Product Notes

The VCAN vcan (Catalog #AAA955026) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 3089-3354aa; Partial. The amino acid sequence is listed below: GPDRCKMNPC LNGGTCYPTE TSYVCTCVPG YSGDQCELDF DECHSNPCRN GATCVDGFNT FRCLCLPSYV GALCEQDTET CDYGWHKFQG QCYKYFAHRR TWDAAERECR LQGAHLTSIL SHEEQMFVNR VGHDYQWIGL NDKMFEHDFR WTDGSTLQYE NWRPNQPDSF FSAGEDCVVI IWHENGQWND VPCNYHLTYT CKKGTVACGQ PPVVENAKTF GKMKPRYEIN SLIRYHCKDG FIQRHLPTIR CLGNGRWAIP KITCMN. It is sometimes possible for the material contained within the vial of "Versican core protein (VCAN), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.