Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

5-hydroxytryptamine receptor 3A (HTR3A) Recombinant Protein | HTR3A recombinant protein

Recombinant Human 5-hydroxytryptamine receptor 3A (HTR3A)

Gene Names
HTR3A; HTR3; 5HT3R; 5-HT-3; 5-HT3A; 5-HT3R
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5-hydroxytryptamine receptor 3A (HTR3A); Recombinant Human 5-hydroxytryptamine receptor 3A (HTR3A); Recombinant 5-hydroxytryptamine receptor 3A (HTR3A); 5-hydroxytryptamine receptor 3A; 5-HT3-A; 5-HT3A; 5-hydroxytryptamine receptor 3; 5-HT-3; 5-HT3R Serotonin receptor 3A Serotonin-gated ion channel receptor; HTR3A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-241aa; partial, provide the complete extracellular domain
Sequence
RRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRRR
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,280 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 3A isoform b
NCBI Official Synonym Full Names
5-hydroxytryptamine (serotonin) receptor 3A, ionotropic
NCBI Official Symbol
HTR3A
NCBI Official Synonym Symbols
HTR3; 5HT3R; 5-HT-3; 5-HT3A; 5-HT3R
NCBI Protein Information
5-hydroxytryptamine receptor 3A; 5-HT3-A; serotonin receptor 3A; 5HT3 serotonin receptor; serotonin-gated ion channel receptor
UniProt Protein Name
5-hydroxytryptamine receptor 3A
UniProt Gene Name
HTR3A
UniProt Synonym Gene Names
5HT3R; HTR3; 5-HT3-A; 5-HT3A; 5-HT-3; 5-HT3R
UniProt Entry Name
5HT3A_HUMAN

NCBI Description

The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

5-HT(3): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses in neurons. It is a cation-specific, but otherwise relatively nonselective, ion channel. Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3A sub-subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Channel, cation; Channel, ligand-gated; Transporter, ion channel; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q23.1

Cellular Component: postsynaptic membrane; cell soma; integral to plasma membrane; axon; cytoplasm; plasma membrane; cell junction

Molecular Function: voltage-gated potassium channel activity; serotonin-activated cation-selective channel activity; serotonin binding; serotonin receptor activity; receptor activity

Biological Process: synaptic transmission; response to ethanol; transport; digestion; response to cocaine; transmembrane transport; serotonin receptor signaling pathway

Research Articles on HTR3A

Similar Products

Product Notes

The HTR3A htr3a (Catalog #AAA952426) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-241aa; partial, provide the complete extracellular domain. The amino acid sequence is listed below: RRSRNTTRPA LLRLSDYLLT NYRKGVRPVR DWRKPTTVSI DVIVYAILNV DEKNQVLTTY IWYRQYWTDE FLQWNPEDFD NITKLSIPTD SIWVPDILIN EFVDVGKSPN IPYVYIRHQG EVQNYKPLQV VTACSLDIYN FPFDVQNCSL TFTSWLHTIQ DINISLWRLP EKVKSDRSVF MNQGEWELLG VLPYFREFSM ESSNYYAEMK FYVVIRRR. It is sometimes possible for the material contained within the vial of "5-hydroxytryptamine receptor 3A (HTR3A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.