Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC) Recombinant Protein | PPP1CC recombinant protein

Recombinant Human Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC)

Cat. Num. AAA952100

• Gene Names: PPP1CC; PP1C; PP-1G; PPP1G
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC); Recombinant Human Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC); PPP1CC recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-323. Full Length of Mature Protein
• Sequence: ADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 350276247
• NCBI GeneID: 5501
• NCBI Accession #: NP_001231903.1
• NCBI GenBank Nucleotide #: NM_001244974.1
• UniProt Accession #: P36873
• Molecular Weight: 44.3 kDa
• NCBI Official Full Name: serine/threonine-protein phosphatase PP1-gamma catalytic subunit isoform 2
• NCBI Official Synonym Full Names: protein phosphatase 1 catalytic subunit gamma
• NCBI Official Symbol: PPP1CC
• NCBI Official Synonym Symbols: PP1C; PP-1G; PPP1G
• NCBI Protein Information: serine/threonine-protein phosphatase PP1-gamma catalytic subunit
• UniProt Protein Name: Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
• Protein Family: Serine/threonine-protein phosphatase
• UniProt Gene Name: PPP1CC
• UniProt Synonym Gene Names: PP-1G

NCBI Description

The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Dephosphorylates RPS6KB1. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208).