Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PPP1CCSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PPP1CC Polyclonal Antibody | anti-PPP1CC antibody

PPP1CC Antibody - N-terminal region

Gene Names
PPP1CC; PP1C; PP-1G; PPP1G
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PPP1CC; Polyclonal Antibody; PPP1CC Antibody - N-terminal region; anti-PPP1CC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICG
Sequence Length
323
Applicable Applications for anti-PPP1CC antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PPP1CC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PPP1CCSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPP1CCSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PPP1CC antibody
The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PPP1CC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
serine/threonine-protein phosphatase PP1-gamma catalytic subunit isoform 2
NCBI Official Synonym Full Names
protein phosphatase 1 catalytic subunit gamma
NCBI Official Symbol
PPP1CC
NCBI Official Synonym Symbols
PP1C; PP-1G; PPP1G
NCBI Protein Information
serine/threonine-protein phosphatase PP1-gamma catalytic subunit
UniProt Protein Name
Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
UniProt Gene Name
PPP1CC
UniProt Synonym Gene Names
PP-1G
UniProt Entry Name
PP1G_HUMAN

NCBI Description

The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

PPP1CC: is a catalytic subunit of protein phosphatase 1 (PP1), a ubiquitous cytosolic serine-threonine phosphatase. Composed a catalytic subunit (PPP1CA, PPP1CB or PPP1CC) which is folded into its native form by inhibitor 2 and glycogen synthetase kinase 3, and then complexed to one or several targeting (or regulatory) subunits: PPP1R12A and PPP1R12B mediate binding to myosin; PPP1R3A, PPP1R3B, PPP1R3C and PPP1R3D mediate binding to glycogen; and PPP1R15A and PPP1R15B mediate binding to EIF2S1. PP1 is essential for cell division, plays critical roles in many cellular processes including glycogen metabolism, muscle contractility and protein synthesis, and is involved in the regulation of ionic conductances and long-term synaptic plasticity. Inhibits the synthesis of proteins involved in synaptic plasticity. Binds to the transcription factor cyclic AMP-dependent response element binding (CREB) and dephosphorylates it. May regulate chromatin condensation through regulation of histone H3 phosphorylation. Differentially expressed in gastric cancer. May participate in the neurodegenerative progress in Alzheimer's disease. Down-regulated in lung squamous cell carcinoma.

Protein type: EC 3.1.3.16; Motility/polarity/chemotaxis; Protein phosphatase, Ser/Thr (non-receptor); Nucleolus

Chromosomal Location of Human Ortholog: 12q24.1-q24.2

Cellular Component: focal adhesion; protein complex; mitochondrion; cytoplasm; nucleolus; nuclear speck; midbody; cytosol; nucleus; cleavage furrow

Molecular Function: protein binding; metal ion binding; phosphoric monoester hydrolase activity; protein serine/threonine phosphatase activity; phosphoprotein phosphatase activity; protein kinase binding

Biological Process: glycogen metabolic process; cell division; transforming growth factor beta receptor signaling pathway; triacylglycerol catabolic process; mitotic cell cycle; circadian regulation of gene expression; regulation of circadian rhythm; protein amino acid dephosphorylation; negative regulation of transforming growth factor beta receptor signaling pathway; entrainment of circadian clock by photoperiod

Research Articles on PPP1CC

Similar Products

Product Notes

The PPP1CC ppp1cc (Catalog #AAA3223091) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP1CC Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1CC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP1CC ppp1cc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QRLLEVRGSK PGKNVQLQEN EIRGLCLKSR EIFLSQPILL ELEAPLKICG. It is sometimes possible for the material contained within the vial of "PPP1CC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.