Proteasome subunit beta type-10 (PSMB10) Recombinant Protein | PSMB10 recombinant protein

Recombinant Human Proteasome subunit beta type-10 (PSMB10)

Cat. Num. AAA951722

• Gene Names: PSMB10; LMP10; MECL1; beta2i
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Proteasome subunit beta type-10 (PSMB10); Recombinant Human Proteasome subunit beta type-10 (PSMB10); Proteasome subunit beta type-10; EC=3.4.25.1; Low molecular mass protein 10; Macropain subunit MECl-1; Multicatalytic endopeptidase complex subunit MECl-1; Proteasome MECl-1; Proteasome subunit beta-2i; PSMB10 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-273aa; Full Length
• Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
• Sequence Length: 234

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for PSMB10 recombinant protein

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.

Product Categories/Family for PSMB10 recombinant protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 4506191
• NCBI GeneID: 5699
• NCBI Accession #: NP_002792.1
• NCBI GenBank Nucleotide #: NM_002801.3
• UniProt Accession #: P40306; Q5U098; B2R5J4
• Molecular Weight: 51.6 kDa
• NCBI Official Full Name: proteasome subunit beta type-10
• NCBI Official Synonym Full Names: proteasome (prosome, macropain) subunit, beta type, 10
• NCBI Official Symbol: PSMB10
• NCBI Official Synonym Symbols: LMP10; MECL1; beta2i
• NCBI Protein Information: proteasome subunit beta type-10; proteasome MECl-1; macropain subunit MECl-1; proteasome subunit MECL1; proteasome subunit beta 7i; proteasome subunit beta-2i; low molecular mass protein 10; proteasome catalytic subunit 2i; multicatalytic endopeptidase complex subunit MECl-1
• UniProt Protein Name: Proteasome subunit beta type-10
• Protein Family: Proteasome
• UniProt Gene Name: PSMB10
• UniProt Synonym Gene Names: LMP10; MECL1
• UniProt Entry Name: PSB10_HUMAN

NCBI Description

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Proteolytic processing is required to generate a mature subunit. Expression of this gene is induced by gamma interferon, and this gene product replaces catalytic subunit 2 (proteasome beta 7 subunit) in the immunoproteasome. [provided by RefSeq, Jul 2008]

Uniprot Description

PSMB10: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Belongs to the peptidase T1B family.

Protein type: Protease; EC 3.4.25.1; Proteasome complex

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: proteasome complex; nucleoplasm; proteasome core complex; cytosol

Molecular Function: threonine endopeptidase activity

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; viral reproduction; apoptosis; cell morphogenesis; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; humoral immune response; T cell proliferation; regulation of apoptosis; antigen processing and presentation of peptide antigen via MHC class I; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I; gene expression; mitotic cell cycle; regulation of amino acid metabolic process; G1/S transition of mitotic cell cycle; negative regulation of apoptosis