Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TGF-beta receptor type-1 (Tgfbr1) Recombinant Protein | Tgfbr1 recombinant protein

Recombinant Rat TGF-beta receptor type-1 (Tgfbr1), partial

Gene Names
Tgfbr1; Alk5; Skr4; Tgfr-1; tbetaR-I
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
TGF-beta receptor type-1 (Tgfbr1); Recombinant Rat TGF-beta receptor type-1 (Tgfbr1); partial; Tgfbr1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
30-124\naa, Extracellular domain
Sequence
LQCFCHLCTKDNFTCETDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTYCCNQDHCNKIELPTTGPFSEKQSAGLGPVEL
Sequence Length
501
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Tgfbr1 recombinant protein
This protein forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine
threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,000 Da
NCBI Official Full Name
TGF-beta receptor type-1 isoform X1
NCBI Official Synonym Full Names
transforming growth factor, beta receptor 1
NCBI Official Symbol
Tgfbr1
NCBI Official Synonym Symbols
Alk5; Skr4; Tgfr-1; tbetaR-I
NCBI Protein Information
TGF-beta receptor type-1
UniProt Protein Name
TGF-beta receptor type-1
Protein Family
UniProt Gene Name
Tgfbr1
UniProt Synonym Gene Names
TGFR-1; SKR4; TGF-beta receptor type I; TbetaR-I

NCBI Description

forms a heteromeric receptor complex with TGF-beta type II receptor that binds TGF-beta and mediates TGF-beta signalling [RGD, Feb 2006]

Uniprot Description

Transmembrane serine/threonine kinase forming with the TGF-beta type II serine/threonine kinase receptor, TGFBR2, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways. For instance, TGFBR1 induces TRAF6 autoubiquitination which in turn results in MAP3K7 ubiquitination and activation to trigger apoptosis. Also regulates epithelial to mesenchymal transition through a SMAD-independent signaling pathway through PARD6A phosphorylation and activation ().

Research Articles on Tgfbr1

Similar Products

Product Notes

The Tgfbr1 tgfbr1 (Catalog #AAA951187) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-124naa, Extracellular domain. The amino acid sequence is listed below: LQCFCHLCTK DNFTCETDGL CFVSVTETTD KVIHNSMCIA EIDLIPRDRP FVCAPSSKTG AVTYCCNQDH CNKIELPTTG PFSEKQSAGL GPVEL. It is sometimes possible for the material contained within the vial of "TGF-beta receptor type-1 (Tgfbr1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.