IgG receptor FcRn large subunit p51 (Fcgrt) Recombinant Protein | Fcgrt recombinant protein
Recombinant Rat IgG receptor FcRn large subunit p51 (Fcgrt), partial
Gene Names
Fcgrt; FcRn
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
IgG receptor FcRn large subunit p51 (Fcgrt); Recombinant Rat IgG receptor FcRn large subunit p51 (Fcgrt); partial; Fcgrt recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-298aa, Extracellular domain
Sequence
AEPRLPLMYHLAAVSDLSTGLPSFWATGWLGAQQYLTYNNLRQEADPCGAWIWENQVSWYWEKETTDLKSKEQLFLEAIRTLENQINGTFTLQGLLGCELAPDNSSLPTAVFALNGEEFMRFNPRTGNWSGEWPETDIVGNLWMKQPEAARKESEFLLTSCPERLLGHLERGRQNLEWKEPPSMRLKARPGNSGSSVLTCAAFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWSLLEVKRGDEHHYQCQVEHEGLAQPLTVDLDSPARSS
Sequence Length
366
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Fcgrt recombinant protein
This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,169 Da
NCBI Official Full Name
IgG receptor FcRn large subunit p51
NCBI Official Synonym Full Names
Fc fragment of IgG receptor and transporter
NCBI Official Symbol
Fcgrt
NCBI Official Synonym Symbols
FcRn
NCBI Protein Information
IgG receptor FcRn large subunit p51
UniProt Protein Name
IgG receptor FcRn large subunit p51
Protein Family
UniProt Gene Name
Fcgrt
UniProt Synonym Gene Names
Fcrn; FcRn
NCBI Description
binds and transports maternal immunoglobulin gamma from milk; plays a role in providing maternal immunity to neonates [RGD, Feb 2006]
Uniprot Description
Binds to the Fc region of monomeric immunoglobulins gamma (PubMed:18818657, PubMed:7969498). Mediates the selective uptake of IgG from milk and helps newborn animals to acquire passive immunity. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids (PubMed:7298722, PubMed:18818657). Possible role in transfer of immunoglobulin G from mother to fetus ().
Research Articles on Fcgrt
Similar Products
Product Notes
The Fcgrt fcgrt (Catalog #AAA951057) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-298aa, Extracellular domain. The amino acid sequence is listed below: AEPRLPLMYH LAAVSDLSTG LPSFWATGWL GAQQYLTYNN LRQEADPCGA WIWENQVSWY WEKETTDLKS KEQLFLEAIR TLENQINGTF TLQGLLGCEL APDNSSLPTA VFALNGEEFM RFNPRTGNWS GEWPETDIVG NLWMKQPEAA RKESEFLLTS CPERLLGHLE RGRQNLEWKE PPSMRLKARP GNSGSSVLTC AAFSFYPPEL KFRFLRNGLA SGSGNCSTGP NGDGSFHAWS LLEVKRGDEH HYQCQVEHEG LAQPLTVDLD SPARSS. It is sometimes possible for the material contained within the vial of "IgG receptor FcRn large subunit p51 (Fcgrt), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
