Urotensin-2 receptor (UTS2R) Recombinant Protein | UTS2R recombinant protein
Recombinant Bovine Urotensin-2 receptor (UTS2R)
Gene Names
UTS2R; SENR; Gpr14; UR-2-R
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Urotensin-2 receptor (UTS2R); Recombinant Bovine Urotensin-2 receptor (UTS2R); Recombinant Urotensin-2 receptor (UTS2R); Urotensin-2 receptor; UR-2-R; G-protein coupled receptor 14 G-protein coupled sensory epithelial neuropeptide-like receptor; SENR Urotensin II receptor; UR-II-R; UTS2R recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-384
Sequence
MALSPEPSSRFLVPATMGSAMPELPGAPNASLNSSLASPTEPNSLEDLVATGTIGVVLSAMGVVGMAGNVYTLTVMCRFLHTSASMYVYVINLALADLLYLLSIPFIVATYVTKRWHFGDVGCRVLFSLDFLTMHASIFTLTLMSRERYAAVVRPLDTVQRSKGYRKVLALGTWLLALLLALPMMLAIRLVRRGHKSLCLPAWGQRTHRAYLTLLFGTSIVGPGVVIGLLYVRLARAYWLSQRSSFTQTRRLPNPRVLYLILGIVLLFWACFLPFWLWQLLAQYRGAPPLAPRSARIVNYLTTCLTYGNSCVNPFLYTLLTKNYRDYRQRSLHSRGTSGPVGVRSFPQGHTRCQLGSGRSVTSSSQQATETIALSQAVPGSLCV
Sequence Length
384
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,316 Da
NCBI Official Full Name
urotensin-2 receptor
NCBI Official Synonym Full Names
urotensin 2 receptor
NCBI Official Symbol
UTS2R
NCBI Official Synonym Symbols
SENR; Gpr14; UR-2-R
NCBI Protein Information
urotensin-2 receptor; UR-II-R; urotensin receptor; urotensin II receptor; G protein-coupled receptor 14; G-protein coupled receptor 14; G-protein coupled sensory epithelial neuropeptide-like receptor
UniProt Protein Name
Urotensin-2 receptor
Protein Family
UniProt Gene Name
UTS2R
UniProt Synonym Gene Names
GPR14; UR-2-R; SENR; UR-II-R
UniProt Entry Name
UR2R_BOVIN
Uniprot Description
Function: High affinity receptor for urotensin-2 and urotensin-2B. The activity of this receptor is mediated by a G-protein that activate a phosphatidylinositol-calcium second messenger system
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein.
Tissue specificity: Expressed in neural tissue, including sensory epithelia.
Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
Research Articles on UTS2R
Similar Products
Product Notes
The UTS2R uts2r (Catalog #AAA950479) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-384. The amino acid sequence is listed below: MALSPEPSSR FLVPATMGSA MPELPGAPNA SLNSSLASPT EPNSLEDLVA TGTIGVVLSA MGVVGMAGNV YTLTVMCRFL HTSASMYVYV INLALADLLY LLSIPFIVAT YVTKRWHFGD VGCRVLFSLD FLTMHASIFT LTLMSRERYA AVVRPLDTVQ RSKGYRKVLA LGTWLLALLL ALPMMLAIRL VRRGHKSLCL PAWGQRTHRA YLTLLFGTSI VGPGVVIGLL YVRLARAYWL SQRSSFTQTR RLPNPRVLYL ILGIVLLFWA CFLPFWLWQL LAQYRGAPPL APRSARIVNY LTTCLTYGNS CVNPFLYTLL TKNYRDYRQR SLHSRGTSGP VGVRSFPQGH TRCQLGSGRS VTSSSQQATE TIALSQAVPG SLCV. It is sometimes possible for the material contained within the vial of "Urotensin-2 receptor (UTS2R), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
