Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

(Rhesus macaque) Protein S100-A10 (S100A10) Recombinant Protein | S100A10 recombinant protein

Recombinant Macaca mulatta (Rhesus macaque) Protein S100-A10 (S100A10)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
(Rhesus macaque) Protein S100-A10 (S100A10); Recombinant Macaca mulatta (Rhesus macaque) Protein S100-A10 (S100A10); S100A10 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-97
Sequence
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Sequence Length
97
Species
Macaca mulatta (Rhesus macaque)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for S100A10 recombinant protein
S100A10; CAL1L

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,203 Da
NCBI Official Full Name
protein S100-A10
NCBI Official Symbol
S100A10
NCBI Protein Information
protein S100-A10; calpactin I light chain; calpactin-1 light chain; S100 calcium-binding protein A10
UniProt Protein Name
Protein S100-A10
Protein Family
UniProt Gene Name
S100A10
UniProt Synonym Gene Names
CAL1L
UniProt Entry Name
S10AA_MACMU

Uniprot Description

Abi-2: May act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Regulates ABL1/c-Abl-mediated phosphorylation of MENA. Belongs to the ABI family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis

Cellular Component: cell projection; cell-cell adherens junction; cytoskeleton; lamellipodium; dendrite; cytoplasm; cytosol; filopodium

Molecular Function: ubiquitin protein ligase binding; protein complex binding; Rac GTPase binding; SH3 domain binding

Biological Process: cell migration; peptidyl-tyrosine phosphorylation; camera-type eye development; learning and/or memory; actin polymerization and/or depolymerization; dendrite development; Rac protein signal transduction; cell motility

Similar Products

Product Notes

The S100A10 s100a10 (Catalog #AAA950103) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-97. The amino acid sequence is listed below: PSQMEHAMET MMFTFHKFAG DKGYLTKEDL RVLMEKEFPG FLENQKDPLA VDKIMKDLDQ CRDGKVGFQS FFSLIAGLTI ACNDYFVVHM KQKGKK. It is sometimes possible for the material contained within the vial of "(Rhesus macaque) Protein S100-A10 (S100A10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.