Inhibin alpha chain (INHA) Recombinant Protein | INHA recombinant protein
Recombinant Chicken Inhibin alpha chain (INHA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Inhibin alpha chain (INHA); Recombinant Chicken Inhibin alpha chain (INHA); INHA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
217-329, Full length protein
Sequence
SAVPWSPAALSLLQRPSEDVAAHTNCRRASLNISFEELGWDNWIVHPSSFVFHYCHGNCAEGHGLSHRLGVQLCCAALPGTMRSLRVRTTSDGGYSFKYETVPNILAQDCTCV
Sequence Length
113
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for INHA recombinant protein
The inhibin alpha subunit joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth
differentiation factor and a hormone.
differentiation factor and a hormone.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,853 Da
NCBI Official Full Name
inhibin alpha chain
NCBI Official Synonym Full Names
inhibin alpha subunit
NCBI Official Symbol
INHA
NCBI Protein Information
inhibin alpha chain
UniProt Protein Name
Inhibin alpha chain
Protein Family
UniProt Gene Name
INHA
Uniprot Description
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Research Articles on INHA
Similar Products
Product Notes
The INHA inha (Catalog #AAA950050) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 217-329, Full length protein. The amino acid sequence is listed below: SAVPWSPAAL SLLQRPSEDV AAHTNCRRAS LNISFEELGW DNWIVHPSSF VFHYCHGNCA EGHGLSHRLG VQLCCAALPG TMRSLRVRTT SDGGYSFKYE TVPNILAQDC TCV. It is sometimes possible for the material contained within the vial of "Inhibin alpha chain (INHA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
