Western Blot (WB)
(WB Suggested Anti-C11orf74 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Rabbit anti-Human C11orf74 Polyclonal Antibody | anti-C11ORF74 antibody
C11orf74 antibody - middle region
Gene Names
C11orf74; NWC; HEPIS
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C11orf74; Polyclonal Antibody; C11orf74 antibody - middle region; anti-C11ORF74 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD
Sequence Length
221
Applicable Applications for anti-C11ORF74 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C11orf74
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-C11orf74 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-C11orf74 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-C11ORF74 antibody
This is a rabbit polyclonal antibody against C11orf74. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The exact function of C11orf74 remains unknown.
Target Description: The exact function of C11orf74 remains unknown.
Product Categories/Family for anti-C11ORF74 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
uncharacterized protein C11orf74 isoform a
NCBI Official Synonym Full Names
chromosome 11 open reading frame 74
NCBI Official Symbol
C11orf74
NCBI Official Synonym Symbols
NWC; HEPIS
NCBI Protein Information
uncharacterized protein C11orf74
UniProt Protein Name
Uncharacterized protein C11orf74
UniProt Gene Name
C11orf74
UniProt Entry Name
CK074_HUMAN
NCBI Description
This gene encodes a protein that was identified as a cellular interacting partner of non-structural protein 10 of the severe acute respiratory syndrome coronavirus (SARS-CoV). The encoded protein may function as a negative regulator of transcription. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]
Uniprot Description
C11orf74: 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 11p12
Research Articles on C11ORF74
Similar Products
Product Notes
The C11ORF74 c11orf74 (Catalog #AAA3210891) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C11orf74 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C11orf74 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the C11ORF74 c11orf74 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VQLFSLDEEF DYDNVMLTSK FSPAEIENIK ELCKQQKRKD TSPDLEKSCD. It is sometimes possible for the material contained within the vial of "C11orf74, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
